KEGG   Drosophila ananassae: Dana_GF13366Help
Entry
Dana_GF13366      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dan  Drosophila ananassae
Pathway
dan00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dana_GF13366
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dana_GF13366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 EF-hand_8 EF-hand_5 EF-hand_9 FAD_oxidored GIDA Pyr_redox_2 FAD_binding_3 NAD_binding_8 HI0933_like
Motif
Other DBs
NCBI-GeneID: 6496208
NCBI-ProteinID: XP_001960453
FlyBase: FBgn0090398
UniProt: B3MCF1
LinkDB All DBs
Position
Unknown
AA seq 726 aa AA seqDB search
MTSRMFKFGVTAASACVGSVLASYTLDRWNSPHVVNNAVQRPPKRKRTLPPRADQIKSLM
SGEEFDVLIIGGGATGAGCALDSVTRGLKTALVELDDFASGTSSRSTKLIHGGVRYLQKA
ILGLDFEQYRMVKEALQERATMLESAPHLTHPLPIMLPVYTWWQVPYYWVGIKCYDLVAG
DRNVKSSYYLSKKDALELFPMLKKDKLCGAIVYYDGQQDDARMCLAVALTAARHGATVCN
HVEVKELLKKDDGTGKQVLCGAKVKDHISGKEFIVKAKCIVNAAGPFTDSIRKMDNPTVK
TICSPSSGVHIVLPGYYSPDQMGLLDPSTSDGRVIFFLPWQRQTIAGTTDLPCEITHSPT
PTEDEIQFILNEIKNYLNADVEVRRGDVLSAWSGIRPLVSDPNKDDTQSLARNHIVHVSP
SNLVTIAGGKWTTYRAMAEHTIDAAIKACNLKPERAEAVTSYLKIEGGQGWTPTMYIRLV
QDFGLECEVAQHLAKSYGDRAFAVSKMASLTGKRWPIIGNRIHPEFPYIDAEIRYGVREY
ACTAVDMIARRLRLAFLNVQAAQEALPVIVDIMGEELNWSKDEKERQIKAATEFLANEMG
HSVNRTSKERIPIKLSKEEIQTYIKRFQLIDKDKKGYVSINDIRRALKNFGDGDVSGEQL
HDILREIDTNMNGQVELDEYLQMMSAIKTGDVAYSRFARMAELEEQKHEAANLKQKISVD
RSGGGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcgaatgttcaagttcggcgtcacagccgccagcgcctgcgtgggctccgtt
ctggcgtcctataccttggaccgctggaactcgccccatgtggtgaacaatgctgtgcag
cgtccgccaaagaggaagcgcaccttgccccccagggctgaccagataaagtccctgatg
agtggcgaggagttcgatgtgctgatcatcggcggaggagccaccggagcgggctgtgcc
ctcgattcggtcaccagaggcctcaagacagccctggtggagctggatgacttcgccagc
ggcacgtcctcacggtccaccaagctcatccatggcggagtccgctacctgcagaaggcc
attctcggcctagactttgagcagtaccgcatggtgaaggaggctcttcaggagcgcgcc
accatgctggagtcggcgccccacctgacccacccgttgcccatcatgctgccagtttac
acgtggtggcaggtgccctactactgggtaggcatcaagtgctacgatctggtggccggt
gaccgcaacgtgaagagctcctactacctctcaaagaaggacgccctggaactgttcccc
atgctcaaaaaggataagctgtgcggcgccattgtgtactacgacggccagcaggacgac
gctaggatgtgcctggcggtggcgttgaccgcggcgcgccacggcgctaccgtgtgcaac
cacgtcgaggtgaaggagctgctcaagaaggatgacggcactggcaagcaggtgctatgc
ggagccaaggtcaaggatcatatctccggcaaggagttcattgtgaaggccaagtgcatc
gtgaatgccgccggcccgttcacggatagcatccgcaagatggacaaccccacggtgaag
accatctgctcccccagctcgggagtgcacatcgtactgccaggctactacagccctgac
cagatgggtctgctggatccctcgacttccgacggccgcgtcatcttcttcttgccctgg
cagcggcagacgatcgccggcaccacggatctgccctgcgagattacccactcgcccacc
cccaccgaggacgagatccagttcatccttaacgaaatcaagaactatctcaatgccgat
gtggaggtgcgccgtggcgacgtactctccgcctggagcggcattcgccccctggtctcg
gaccccaacaaagatgacacccagtccctggcccgcaaccacattgtccacgtgagcccc
tccaacctcgtgaccattgcgggcggcaagtggactacctaccgcgcgatggccgagcac
accatcgacgctgccattaaggcctgtaatctcaaaccggagcgcgcggaggccgtaacc
tcctacctgaagattgagggcggacagggctggactcccaccatgtacattcgccttgtg
caggacttcgggctcgagtgcgaggtggctcagcacctggccaaatcgtacggcgaccgc
gccttcgccgtgtcgaagatggcctccctgactggcaagcgctggcccatcatcggcaac
cgcatccaccccgagttcccctacatcgacgccgaaatccgttacggagtgcgcgagtac
gcctgcaccgccgtggacatgattgcccgccgcctgcgcctagcgttcctcaacgtccaa
gctgcccaggaggcactgcctgtcatcgtggacatcatgggtgaggagctgaactggtcg
aaggatgaaaaggagcgtcagatcaaggcagccaccgagttcctggccaacgaaatgggc
cactcggtcaaccgcacttccaaggagcgcatacccatcaagctctccaaggaggagatt
cagacctacatcaagcgcttccagttgatcgacaaggacaagaagggctatgtctctatt
aacgacatccggcgggcgctcaagaatttcggagacggcgacgtgtccggcgaacagctg
catgatattctgcgcgagatcgacaccaacatgaacggtcaggtggagctcgacgagtac
ctccagatgatgtccgccatcaaaacgggcgacgtggcctactcccgattcgcgcggatg
gccgagctggaggagcagaagcacgaggcggccaacctgaagcagaagatcagtgtggac
cgctccggaggcggtttgtaa

DBGET integrated database retrieval system