KEGG   Drosophila ananassae: Dana_GF13459Help
Entry
Dana_GF13459      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
dan  Drosophila ananassae
Brite
KEGG Orthology (KO) [BR:dan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dan01001]
    Dana_GF13459
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dan04090]
    Dana_GF13459
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     Dana_GF13459
Protein kinases [BR:dan01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   Dana_GF13459
Cytokine receptors [BR:dan04050]
 Receptor tyrosine kinase
  RTK class X (LTK receptor family)
   Dana_GF13459
CD molecules [BR:dan04090]
 Proteins
  Dana_GF13459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr MAM Pkinase Gly_rich Ldl_recept_a Chordopox_A13L FXa_inhibition Pox_LP_H2 RIFIN
Motif
Other DBs
NCBI-GeneID: 6496298
NCBI-ProteinID: XP_001960643
FlyBase: FBgn0090488
UniProt: B3MDK2
LinkDB All DBs
Position
Unknown
AA seq 1708 aa AA seqDB search
MPPLRHLAVQLLVVLLLVAVDPSMAQRPFILNHTFSSLPMSQHPSFNTWPGSSGKQLRNG
RLHEQPLPLPQPTLQVATQYVDYETAPPGSRRQDSKRRQSLAQLASRPGSIGRGGIDSLR
KELMNPSVGGPGGGISGHGAGYSSYPASSTIGRIDGLGHVGTFNHFGEPMRQPTGMAAMT
AGPYSTRFPPSYGGADDLPKRMPPRKNSINELYKLKKSLNQADEPAGGVTHGNLDGDPQA
ASVDPLQDIKDRIRDTAPIANTYAPHTDATPSTEYEYELGVKCNFESRCSWSWVEYPDGF
QVISGAELAKKNLTGMHPGPAADSIDDATGHFLYARVQPNSRPLNLTSPEFSTTMEKCYL
EVYMHQSDMSHGLSRVVVEPLHTQESSWVPAEIQGDNVRQWTRKVYRLGRVSRDFRIVFE
IVPDLRVGQKGHVALDNLRMVNCFPEGTKSEKCSTSQVRCTSNKVPVCIHLPRICDITRD
CDEAEDEQQSCDKIPYGGRCDFEEDWCGWRDSGKTTLTWSRHTGSSPTHDTGPDGDHTMQ
HLLNNTSGYYMLVNMNQHMNNTEKNSIIGFASNAIMLSKTFNPPPSVHGNPDSPYRNSCV
VRFFIHQFGKNPGSINLSVVEMKEKENITTTLWWSTKNQGSDWLRAEYVLPNITSKYYLQ
FEARMGMRIYSDVAVDDFSLSPECFGLNIPEDHLNGYNYWDVRQNLKSPTYKDFEHTNYL
ELTSCDTRGMIGPTQAQCESSYREQNKTHILREVHVVEDQSTYKGMQKWKVPHEGHYTII
AKGASGGLGSGGVGSSRGSVAVAILELHKHEELYFLVGQQGENACIKSMGLHKEPGCGTD
HDLDLAQYSFRSKQDMVKKIYIENGAGGGGGGSYVFLLNQAKNEAVPLLVAGGGGGLGIG
QYIDEDFQHGQKAKPNQPPESGQINGEPLNKKTAGPGGGWRAKEDQALSPTYGAALLQGG
RGGHSCYVELADNGTSVHRHGQGGFGGGGGGCNTGGGGGGYAGGDVYLTESNGEGGSSYI
SPTRSLREISGIQAGASSGAGAIIIIPAIEGCGCDYRCVALDEFRSTVRCICPDGWSLKR
DNNTACEIREEAGKSSFQYLVSFLMVSLAVLFICIALLIFMLYNRYQRKKQSKKRHKMLV
EQDLQLTRLRNNIDDSNLNNFNPNYGCDGILNGHIDVNSLPQVARDSLQLVNALGKGAFG
EVYMALYRHRDGDAVEMGVAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCFD
RQPYYIVLELLAGGDLQKFLRENRNTPERPSLLTMKDLLFCALDVAKGCRYMESKRFIHR
DIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYYRKGGKAMLPIKWMPPEAFLDGIFTS
KTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPVSIYKVMADCWNP
TPEDRPTFISLLEHLTACTQDPSIMNAPLPNILGPTASERDDTVIRPPNGEEFCLAVPDY
LVPLPPGGSSGLGTPQMASGSGGYGAESQRQQMSSCTPPAITSPAAPHPPRSGESANPGS
GDCWETSFILPNSKSEQPNGAAGGSSCSKDLPLASNEEAKLISLDTPQATPTTIQPPLSF
ASQLDGITLDPSTLSKSLPNGSAKQSYANVQVKGEADAKVPNGSALVANGSVMNGDLATG
ASGADSPFTIQGYADRYKDNNNHSEISC
NT seq 5127 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgctcaggcatctggcagttcagctgctggtggtgctactgctggtggctgtg
gatccctcgatggcccagcggccgttcatcctgaaccacaccttcagttcgctgccaatg
tcccagcatccgagcttcaatacctggccgggatcctccggaaagcagctgcgaaacggc
cggctccatgagcagcccttgccccttcctcagcccacattacaggtggctacgcagtac
gtggattatgaaacagccccgccaggatctcgacgccaggactccaagcgccgccagagt
ctggcccaactagcctctcgtcccggaagcatcggacgaggcggcatcgattcgctgcgc
aaggagctgatgaatccttccgtgggcggaccaggtggcggcatctccggccacggtgcc
ggctattcctcctacccagcttcctcgactatcggacgtatcgacggcctggggcatgtc
ggaacattcaaccacttcggcgaaccgatgagacagcccaccggaatggccgccatgacc
gccggaccctactctactcgttttcctccatcctatggaggagctgatgacctgccgaag
cgaatgccgccgcggaagaactccatcaacgagctgtacaagctgaagaagagcctgaac
caggcggacgagcccgctggcggagtcacccacggaaatttggatggcgacccgcaggct
gcctccgtggatcccttgcaagacatcaaggaccgcatccgcgatacagctcccattgcg
aacacctatgccccccatacggacgccacgccctcaacggagtacgaatacgaactgggc
gtcaagtgcaacttcgagtcacgttgcagctggtcttgggtggaatatccagatggattc
caagtgatcagcggtgctgagctggctaaaaagaatctaacgggcatgcatccaggacct
gccgctgatagcatagacgatgccaccggccatttcctgtacgcccgtgtccagcccaac
tccaggccactgaatctcacctccccagagtttagcaccaccatggagaagtgctacctg
gaggtctacatgcaccagagcgacatgagtcacggactgtcccgtgtcgtagtggagccc
ttgcacacgcaagagagtagctgggttccagcggagatccagggcgacaatgtgcgccag
tggacccggaaggtgtatcgcctgggtcgggtttcccgcgactttcgcatcgttttcgaa
atcgttcccgatctgcgagtaggccagaagggccacgtggccctggacaacctgcggatg
gtgaactgcttcccggagggcaccaagtcggaaaagtgcagcacctcccaggtgcgatgc
acttccaacaaggttcccgtttgcattcatctgccaaggatttgcgatattacccgggac
tgtgacgaggcggaggatgaacaacaatcttgtgacaaaataccctacggtggacgctgt
gacttcgaggaggactggtgcggatggcgagactctggaaagaccactctgacttggtct
cgccacacgggatcctcgcccacccacgacactggcccggatggggatcacaccatgcag
cacctgctgaataacaccagtggctactacatgctcgtcaatatgaaccagcacatgaac
aacaccgagaagaactccatcattggctttgccagcaatgccattatgctcagcaagacc
ttcaatccgccaccttcggtgcatgggaatccagactccccttaccggaactcctgcgtg
gtcaggttctttatccatcaatttggcaagaatcctggcagcattaacctttccgtggtg
gagatgaaggagaaggagaacataaccaccacattgtggtggagcaccaagaaccaggga
agcgattggctacgagcggaatatgtcctgcccaacattacgtccaaatactatcttcaa
tttgaagcccgcatgggcatgagaatctactcagatgtggctgtggacgatttctcacta
agtccggaatgttttggcctcaatattccggaggatcacttgaatggctacaattactgg
gatgtgcggcagaatctgaagagtccaacctacaaggactttgagcacaccaattatctg
gagctaaccagttgcgacaccaggggcatgataggacctacgcaggcacagtgtgagtca
tcctacagggaacagaacaagacgcatatcctgcgggaggtccatgtagttgaggaccaa
agtacctacaagggcatgcaaaagtggaaggtgccccacgagggtcattacacgatcatt
gccaaaggtgccagtggtggtctgggctccggaggagttggcagctcccgaggatcggtg
gctgtagcaattctagaactccacaagcacgaggagctgtacttcctggtgggacagcaa
ggcgagaacgcctgcattaagtccatgggtctgcacaaggagccaggatgtggcacggac
cacgatcttgacctggcccagtacagcttccgttccaagcaggacatggtgaagaaaatc
tacatcgagaatggagctggagggggaggcggtggctcttatgtcttcctcctgaatcag
gctaaaaacgaagcagttcccctattagtagccggcggaggaggcggcctgggcattggc
cagtacatcgacgaggacttccagcacggccaaaaggccaagccgaaccagcccccggaa
agtggacagatcaatggtgaacctctgaacaaaaagaccgcaggccccggaggtggatgg
cgtgccaaggaggatcaggccttgagtccaacgtatggagctgctttgttgcagggtgga
cgtggtggtcactcctgctatgtcgaactggcagacaacggcacctccgtccaccgacat
ggccagggaggattcggtggcggcggtggaggctgcaacacaggaggcggcggaggtggt
tatgccggcggagatgtttacctcacagaatccaacggcgaaggtggcagctcctacatc
agtcccactcgcagtctccgggagatcagtggcatccaggcgggagccagtagtggagca
ggggctatcattattatcccagccatcgagggctgtggctgtgactacaggtgcgtggcc
ctggatgagttccggtcgacggtgcgctgcatctgtccggatggctggagcctcaagagg
gacaacaacacggcttgcgagatccgcgaggaagcgggcaagtcatccttccagtacctc
gtctccttcctgatggtgtcgctggccgtgctctttatctgcatagctttgctcatcttt
atgttgtacaaccgctaccaacgcaagaagcagtccaagaagcgccacaagatgctggtc
gagcaggatctgcagttgactcgcctgcgaaacaatattgacgactccaatctgaacaac
tttaatcccaactatggatgtgatggcattctcaacgggcacatcgatgtcaacagcttg
ccccaagtggcacgtgatagcttgcagctagtaaatgccctgggcaaaggagcctttggc
gaggtgtacatggctctctatcgccaccgagacggcgatgctgttgaaatgggagtagct
gtgaagacattgagggaggatcccaagcgggaaaaggaagaggacttcctcaaggaggct
gccataatggccaagttcaaccacccgaacatggtgcacctgatcggtgtctgtttcgat
cgccagccgtactacatagtcctggaactgttggccggcggggatctgcaaaagttcctg
cgggagaacaggaacacacccgaaagaccctccctgctgaccatgaaggacctgctcttc
tgcgccctggacgtggccaagggatgccgctacatggagagcaagagattcatccaccgc
gacatcgctgccaggaactgtttgttgagcagcaaaggacccggtcgggtggtgaagatc
gccgacttcggcatgtcccgggatatataccgatcggactactaccggaaaggcggcaag
gccatgctgcccatcaagtggatgccgccagaggcattcctcgacggtatattcacctcc
aagacggatgtctggtccttcggcattctgctgtgggaagtgtttagcttgggtcgctct
ccatatcccggccagcacaatacccaggtgatggagcttgtggtgcgcggcggcaggctg
ggatcacccaccgagtgtcccgtttccatctacaaggtcatggccgactgctggaatcct
acgcccgaggacaggccaacgtttatcagtctgctggagcacctgaccgcctgcacccag
gatccgagcattatgaatgcgccacttccgaacatcctgggaccgacggcctccgagagg
gatgacaccgtcatccggccgcccaacggcgaggagttctgtctggcggtgccggactac
ttggtgcccctgcccccgggtggcagcagtggcctcggcaccccacaaatggccagtggc
tccggtggctacggtgcggaatcgcagcgtcagcaaatgagctcctgtaccccgccggcg
atcacttctccagcggcaccccatccgccacgaagtggggagagtgccaatcccggcagc
ggcgactgctgggagacgtccttcattttgccaaactcgaagagcgaacagccgaatgga
gctgccggaggcagtagctgtagcaaggacctgccactggcctccaacgaggaggccaag
ctgatcagcctagacacaccccaggccacgccgaccaccatccagccaccgttatccttt
gcctcgcagctggacggtatcacgctggatccatccaccttgtcgaagagtttgcccaac
ggaagtgccaagcagtcctacgcaaatgtccaggtgaaaggcgaggcggacgccaaggtg
cccaacggaagtgccctggtggccaacggatccgtgatgaacggcgacctggcgaccgga
gcgagcggagcggattcgcccttcaccattcaaggatatgcggaccgatacaaggacaac
aacaatcattccgaaatcagttgttaa

DBGET integrated database retrieval system