KEGG   Drosophila ananassae: Dana_GF13698Help
Entry
Dana_GF13698      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K02358  elongation factor Tu
Organism
dan  Drosophila ananassae
Brite
Translation factors [BR:dan03012]
 Eukaryotic Type
  Elongation factors
   Dana_GF13698
 Prokaryotic Type
   Dana_GF13698
Mitochondrial biogenesis [BR:dan03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dana_GF13698
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dana_GF13698
  Exosomal proteins of breast cancer cells
   Dana_GF13698
  Exosomal proteins of colorectal cancer cells
   Dana_GF13698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 6496534
NCBI-ProteinID: XP_001961091
FlyBase: FBgn0090725
UniProt: B3MGZ5
LinkDB All DBs
Position
Unknown
AA seq 489 aa AA seqDB search
MSHAFAAAVCRSAAPLALRCSRRTMSSSTARMLRLATVTTASSAAHKNWHRQGLLAANTG
NLQQYLRQYANEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEI
DNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATD
GAMPQTREHMLLAKQIGIDHIVVFINKVDAADQEMVDLVEMEIRELLTEMGYDGDKIPVV
KGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVT
GRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKR
GMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPDKDM
VMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTKIMPGLTETQRSELTEGKKA
REKKVAAKK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgcatttgccgccgctgtctgccggtccgccgcccccctggctctgcgatgc
agccggaggaccatgagctcctccacggcaagaatgctgcgcctagctacggtcaccact
gcttcctccgctgcccacaagaactggcaccgccagggacttctcgccgccaacaccggc
aacctgcagcagtacctgcgccaatacgccaacgagaaaaaggtgttcgagcgcaccaag
cctcactgcaacgtgggcaccatcggccatgtggatcacggcaagaccaccctgacagcg
gccatcaccaaggtactggccgacaagcagctggccgagagcaaaaagtacaacgagatc
gacaatgccccggaggagaaggcgcgtggtatcaccattaatgtggcccacgtcgagtac
cagacggagacccgtcattacggacacaccgattgccccggtcatgcggattacatcaag
aacatgatcactggcacggcccagatggacggcgctatcctggtcgtagctgccaccgat
ggtgctatgcctcaaacccgcgaacacatgctgctggccaagcagatcggcatcgaccac
atcgtggtcttcatcaacaaggtggatgccgccgatcaggagatggtggatctggtggaa
atggagatccgtgagctgttaactgagatgggctatgatggtgataagattccggtcgtc
aagggttccgccttgtgcgctttggaagacaagagccctgaaatcggcaaggaggctatc
ctgaagctgctgcaggaggtggacagcttcatcccaacacccgttcgtgagctggataaa
cctttcctgctgcccgtggagaatgtttactcgattcccggacgaggtactgttgtcacc
ggtcgcctggagcgcggtgtggtgaagaagggcatggagtgcgagttcgtcggttacaac
aaggtgctcaagtcgacggtgactggcgtggagatgttccatcaaattctggaggaggcc
caggccggcgaccagctgggagctttggtgcgtggcgtcaaacgcgacgatatcaagcgc
ggaatggtcatgtgcaagcccggcagtgtcaaggctctcgaccagctggaggcgcaggtg
tacattttgtctaaggacgaaggtggccgcaccaaacccttcatgtccttcatccagctt
caaatgttctcgcgtacgtgggattgcgccgtccaagtgcagatccccgacaaggacatg
gtcatgcccggcgaggacaccaagctgattctgcgcctcatccgtcccatggtgctggag
cagggccagcgcttcacactgcgtgacggtaacctgacgctgggcaccggtgtggtcacc
aagatcatgcccggtctgacagagacgcagcgttccgaactgaccgaaggcaagaaggcg
cgggagaagaaggtggccgccaagaagtag

DBGET integrated database retrieval system