KEGG   Drosophila ananassae: Dana_GF18896Help
Entry
Dana_GF18896      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dan  Drosophila ananassae
Pathway
dan00970  Aminoacyl-tRNA biosynthesis
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dana_GF18896
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dan03029]
    Dana_GF18896
Enzymes [BR:dan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dana_GF18896
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dana_GF18896
Mitochondrial biogenesis [BR:dan03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dana_GF18896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF2605 CTK3
Motif
Other DBs
NCBI-GeneID: 6501661
NCBI-ProteinID: XP_001955707
FlyBase: FBgn0095910
UniProt: B3M0M1
LinkDB All DBs
Position
Unknown
AA seq 516 aa AA seqDB search
MHYSIIRRLSTQPKLANIPKRKWKSVVGLEVHAQIASASKLFSGSGTSFGAPLNSSVAYF
DASIPGTLPVVNRKCVESGIKTALALGCRVNEVSMFDRKHYFYADLPNGYQITQQRAALA
NNGIMTFPVITPGKKVYYKTAKLLQLQLEQDSGKSLHDDQLKRSLVDLNRAGLPLMELVF
APDLETGEEAASLVKELILILRRLQTCSCKMEEGALRVDANISINQEGDPMGVRTEVKNI
GSVRSISQAITYEINRQLETVAEGGVITNETRSWDAENRRTVAMRDKEVLQDYRFMPEPN
LPPLHVNLKPGSKSTEDLVSVAALSIEIPELPEDTRQRLVAQYSLKPETAIILVNEPILL
DHFLSINRSLSEVPTKVVYNFLINDFLTYCNKLNLNVEDCSINAEDIRDILKNLHGENIN
LQAARQLIELLHNNPTIKVQELIDLHNLQQICNLEQIEALCQQAITNQPKAVQQYQKGKS
KALFAIVGEVAKLSAQKANMKIVVECLEKLLKPPKK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcattattcaataatccggaggctttctacccagcctaagttggccaacatccctaaa
cgtaaatggaaaagcgttgtaggtttggaggtgcatgctcaaatagccagtgcctcgaag
cttttctcaggtagcggcacctcttttggagctccactcaatagctctgtagcttatttc
gatgcttccataccgggaactttaccggtggtcaataggaagtgtgtggagtctggaatc
aagacagctctagcccttgggtgccgggtgaatgaggtttctatgtttgaccgaaagcat
tacttctatgccgatttgccgaatggctatcaaatcacacagcagcgagctgccctggcc
aacaacggtattatgactttcccggtaataacgccgggcaaaaaagtctactataagact
gcgaaacttctgcaactgcagctggaacaggacagcgggaagtccttacatgacgatcag
cttaagagaagtttggtggatctcaatcgagccggtttgccattgatggagcttgtgttt
gcgccagatcttgaaactggtgaagaggcggcttccttagtcaaagaactaatccttatt
cttagacgtctgcagacctgcagctgcaaaatggaagagggtgccttgcgtgtggatgct
aacatatctataaaccaagagggcgatccaatgggagtccgaacagaagtcaaaaacatt
ggatctgtacgaagtatttctcaagccataacctatgagataaatcgtcagctagaaaca
gtggccgaaggtggtgtaattacgaatgaaacgcgatcttgggatgcggaaaatcgtcgc
acggttgccatgcgtgacaaggaggtgctgcaggactacaggtttatgccagagccgaat
ctgccaccgcttcacgtgaacctgaagccaggttcaaagtcaactgaagacttggtctct
gtagctgctttaagtatagaaattccggaattacccgaagataccagacagcgcttagtg
gcgcagtacagtctcaagccagaaactgctatcattttggtgaatgaacccattttattg
gaccactttttaagtatcaatcgcagtctaagtgaagtgcccaccaaagttgtctacaat
tttcttattaacgattttttgacctactgcaataagctgaacttgaacgtggaggattgc
tctataaacgctgaggatataagagacattttgaagaatcttcacggagaaaatatcaat
ctgcaagctgcgcgtcaactaattgaattgctacacaacaatccaactattaaagtgcag
gagctaattgacctccacaatctgcagcagatctgtaatctggaacagatagaggctctt
tgccagcaagctattaccaaccagcccaaagcagtgcagcaataccaaaagggcaaatca
aaagccctattcgccatcgtaggggaggtggccaaattgtcggcccaaaaagccaacatg
aagattgttgtggagtgtctggaaaaactcctgaaaccccccaagaagtag

DBGET integrated database retrieval system