KEGG   Drosophila ananassae: Dana_GF20979Help
Entry
Dana_GF20979      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform C
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
dan  Drosophila ananassae
Pathway
dan04068  FoxO signaling pathway
dan04144  Endocytosis
dan04350  TGF-beta signaling pathway
dan04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    Dana_GF20979
   04068 FoxO signaling pathway
    Dana_GF20979
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dana_GF20979
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dana_GF20979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3 MNR
Motif
Other DBs
NCBI-GeneID: 6503668
NCBI-ProteinID: XP_001963966
FlyBase: FBgn0097984
UniProt: B3MRL0
LinkDB All DBs
Position
Unknown
AA seq 471 aa AA seqDB search
MLPFTPQVVKRLLALKKGSEDNSVEGKWSEKAVKNLVKKIKKNSQLEELERAISTQNCQT
RCVTVPRSKPAPAGEHLRKGLPHVIYCRLWRWPDLQSQNELKPLDHCEYAFHLRKDEICI
NPYHYKKIELSILVPKSLPTPPDSIVDYPLDNHTHQIPNNTDYNAAIIRSASLSPPQYME
LGGSGSGTGAATSSSTSGAPSSSPSSYQQQQQLSFGQNMDSQSSVLSVGSSIPNTGTPPP
GYMSEDGDPIDPNDNMNMSRLTPPADAAPVMYHEPAFWCSISYYELNTRVGETFHASQPS
ITVDGFTDPSNSERFCLGLLSNVNRNEVVEQTRRHIGKGVRLYYIGGEVFAECLSDSSIF
VQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLSQSVSQGFEAVYQLTRMCTIRM
SFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDRVLTQMGSPRLPCSSMS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgttgccattcacaccgcaggtggtcaagcgattattagcactcaaaaaaggcagcgag
gacaacagcgtcgaaggcaagtggtcggagaaggccgtcaagaacctggtgaagaagata
aagaagaactcgcagttggaggagctagagcgggcaatctccacgcagaactgccagacg
cggtgcgtgacggtgccgcgcagtaagcccgcacccgccggtgagcatctgcggaagggt
ttgccgcacgtcatctattgccgtctgtggcgctggccggatctccagtctcagaatgaa
ctgaagcccctggaccactgcgaatacgccttccatctgcgcaaggacgagatctgcatt
aatccgtatcactacaagaagattgagttgtcgattctggtgccaaagtcgttgcccacg
ccgcccgactccattgtggactatccgctggataaccatactcaccagatacccaacaac
accgactacaatgctgcgataatccgcagcgcctcactgagtccgccgcagtacatggaa
ttgggtggctccggctccggaaccggtgcggccacatccagctcaacttctggggcacca
tcttcctccccctcgtcctaccaacagcagcagcagctgtccttcggccagaatatggac
tcgcaatcgagtgtgctgagcgtgggaagtagcattcccaacacgggcaccccgccgccc
ggctacatgagcgaggatggcgatccgatcgatcccaatgacaacatgaacatgtcccgg
ctgacgccgcccgccgatgccgcaccagtgatgtaccatgagccggccttctggtgctcc
atcagctactacgagctaaatacgcgcgtcggcgagaccttccacgcctcgcagccctca
atcaccgtcgacggcttcaccgatccctctaactcggagcgcttctgtctcggcctactc
tccaatgtcaaccgcaacgaggtggtggagcagacccgccgccacattggcaagggtgtg
cggctctactatatcggcggcgaggtgttcgccgagtgcctgagcgattcgtccatcttc
gtgcagagccccaattgcaaccagcgctacggctggcatccggccaccgtctgcaaaatc
ccgcccggttgcaacctgaagatcttcaacaaccaggagttcgccgccctgctgtcccag
tccgtttcgcagggattcgaggcggtctatcagctcacgcgcatgtgcaccatccggatg
tcgttcgtaaagggctggggagccgagtatcgccgccagacggtcacctcgacgccctgc
tggatcgagctgcacctgaacgggccgctccagtggctggatcgcgtcctcacccagatg
ggatcgccgcggctgccgtgcagctccatgtcctaa

DBGET integrated database retrieval system