KEGG   Drosophila ananassae: Dana_GF21044Help
Entry
Dana_GF21044      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dan  Drosophila ananassae
Brite
KEGG Orthology (KO) [BR:dan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dan01009]
    Dana_GF21044
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dan03019]
    Dana_GF21044
   04131 Membrane trafficking [BR:dan04131]
    Dana_GF21044
   03036 Chromosome and associated proteins [BR:dan03036]
    Dana_GF21044
Enzymes [BR:dan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dana_GF21044
Protein phosphatases and associated proteins [BR:dan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dana_GF21044
Messenger RNA biogenesis [BR:dan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dana_GF21044
Membrane trafficking [BR:dan04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Dana_GF21044
Chromosome and associated proteins [BR:dan03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Dana_GF21044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP FIVAR
Motif
Other DBs
NCBI-GeneID: 6503733
NCBI-ProteinID: XP_001963843
FlyBase: FBgn0098049
UniProt: B3MR87
LinkDB All DBs
Position
Unknown
AA seq 1189 aa AA seqDB search
MSPPIVTRRSAQQAKIQTRAMVNKTKTSTGGGTTSAATAAGVIGSAAGGGSGGPSGGDSR
KSNKPSAALLEAKRRARNLLKSQNNAMATQECVTDIFQNAVNAKGLVRRPTALIYDESMS
QHCCLWDKEHYECPERFTRVLERCRELNLADRCLQLPSRAATKAEVLRLHTEEHFDRLKA
TSGIRDDDRMEELSSRYDSIYIHPSTFELSLLATGSTIELVDQLIAGSAQNGMAIIRPPG
HHAMKAEFNGYCFFNNVALAAQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVLYFS
IHRFEYGSFWPHLHESDYHAIGSGPGTGYTFNVPLNSTGMTNGDYLAIFQQLLLPVALEF
QPELIMVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADSKVAVVLEGGYCLDSLAEG
AALTLRSLLGDPCPPLVEELALPRQELADALLNCICAHRPHWRCLQIQKTYEADELMATD
AVQPKDLHRVRRIWIGGPPPVERYPTRDTAIPLPAEKIASNSARLQVLRAETKLSVPPVR
VCYAYDTQMLQHCNLHDGGHPEQPFRIQSIHQMHKEYALLERMKQLSARAATTDEICLAH
TRSHVNSVRRLLGRDPEELHQLGSTYNSVYLHPRTFDCATLAAGSVLQAVDSVLRGESRS
GICNVRPPGHHAEPDQPHGFCIFNNVAIAAQYAIRDYGLQRVLIVDWDVHHGNGTQHIFE
SNPKVLYVSVHRYEHGAFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQ
VIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTPEGYGMLTHWLSALAGGKIVVCLEGG
YNVNSISYAMTMCTKTLLGDPVPTPQLGAASLQKPATVAYQSCIETLQACLEVQRAHWQS
LEFAGRRLPRDFDPLVGENNNEDFLTASLRQLNISSDQIPEAAPGGPGGDRPDCGEERPS
GSKPKVKVKTLTEYLQENKEALENNEMFAVYPLKTCPHLSLLRPEEVPPSINTGAACSQC
ESSEENWMCLSCRTVACGRYVNEHMQMHCLESEHPLAMSLRDFSVWCYACSSYIDHPRLY
AFLNAAHLDKFREPMAWTHVCPQRADGCYPIGADGRDEDDSAAGCSNICIQLERNQNNXP
LAIRVLDGITDYICTLCPPLRHLLQFLAEHLWPIVERIYLSLLHYFLAH
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcccatcgtcacgcgacgcagcgcccagcaggcgaagatccagacccgcgcc
atggtcaacaaaacgaagacttctacaggtggcggcacgacgtcggccgcaactgcggcg
ggagtgatcggcagcgcagccggtggcggcagcggcggccccagcggcggagattcgcga
aagtcgaacaaaccgagcgcagcgctcttggaggcgaaacgtcgcgcgcgcaatttgctg
aagagccagaacaacgccatggccacccaggagtgtgtcaccgatatattccagaacgca
gtcaatgccaagggcctggtccggagacccacggccctcatctatgacgagtccatgagc
cagcactgctgcctgtgggacaaggagcactacgaatgtcctgaacgctttacacgcgtc
ttggagcgttgccgggagctgaacctggcggaccgctgtctgcagctgccatcccgggca
gccaccaaggcggaggtcctgcgcctacacaccgaggagcacttcgaccggctgaaggcg
acctccgggatccgcgacgacgatcgcatggaggagctaagctcccgctacgattccatc
tacatacatccgtccacttttgagctatctctgctggccactggctccaccatcgagctg
gtggaccagctgattgctgggagcgcccagaatggcatggccatcatccggccgcccggc
caccacgccatgaaggccgagttcaatggctactgcttcttcaacaacgtggccttggcg
gcccagcatgccctggatgtccacaagctgcagcgcatcctgattatcgactacgatgtc
caccacggtcagggaacgcagcgcttcttctataacgatccgagggtgttgtatttctcc
atccatcgcttcgagtacggcagcttctggccgcatcttcacgagtcggattaccacgcc
attggctcgggccccggcactggctacaccttcaacgtgcccttgaacagcactggaatg
acgaacggcgactacctggccatcttccagcaactgctcctgccggtggccctggagttc
cagccggagctgatcatggtttccgctggctacgacgccgcgttgggttgcccggagggg
gagatggaagtgacgccagcctgctatccgcatttattgaatccgctcctgcgtctagcc
gactcgaaggtggctgtggtcctggaaggcggctactgcttggactcgctggccgagggt
gctgctctcaccctgcggtcgcttctcggcgacccctgcccgccgctggtcgaggagctg
gccctgccgcgccaggaactggccgacgccctcctcaattgcatttgtgcccacagaccg
cattggcggtgcctgcagatccagaaaacctacgaagcagacgagctcatggcaacggac
gcagtgcagcccaaggatctgcaccgggttaggcgcatttggatcggaggaccgcccccg
gtcgagcgctaccccacacgggacacagcaattccactgccagccgagaaaatagccagc
aactcggcccgtttgcaagtgctccgcgcagaaacgaagctgtcggtgccgccagttcgc
gtttgctacgcctacgatactcagatgctgcagcactgcaacctgcacgatggcgggcac
ccggagcaaccctttcgcatccagagcatccaccagatgcacaaggagtacgccctgctg
gagcggatgaagcagctctcagcccgggcggccactacagacgaaatttgtctcgcccac
acgcgttcgcatgtgaactcggtgcgccgtctcttgggacgcgacccggaggagttgcac
cagctgggctccacctataattcggtctatctgcacccgcggacctttgactgcgccacc
ctagccgccgggtcagtgctccaggcggtggacagtgtgctgcgcggcgagtcccggagt
ggcatctgcaacgtacggcctcccggccaccacgccgaaccggatcagccgcatggattc
tgcatcttcaacaacgtggccattgccgctcagtatgctattcgcgactacggactacag
cgcgtcctcatcgtcgattgggacgtccatcatggaaacgggacgcagcacattttcgag
tccaacccaaaggtcctgtacgtgagtgtgcatcgctacgaacacggcgccttcttcccc
aagggtccggatggaaacttcgacgtcgtgggcaagggtgccggtagaggcttcaacgta
aacattccctggaacaagaagggcatgggggacttggagtacgcactggccttccagcaa
gtgataatgcccattgcctacgagttcaacccacaactggtgttggtctccgccggattc
gatgccgccattggcgaccccttgggcggctgcaaggtgacgcccgagggctacggcatg
ctcacccactggctctcagcgctggctggcgggaagatcgtcgtgtgcctggaagggggc
tacaacgtgaactccatttcgtacgcgatgaccatgtgcaccaagacgctgctgggcgac
ccagtgccgactccgcagctgggagccgcatcgctccaaaaaccagccacggtggcctac
cagagctgcatcgaaacactgcaggcctgcttggaggtccagcgggcgcactggcagtcg
ctggagttcgccggccgccggctgccgcgcgacttcgatccactggtgggcgagaacaac
aacgaggattttcttactgcttccctgcggcagttgaatatctcgagtgatcagatccca
gaggccgccccgggcggtcccggcggcgatcggccagactgcggcgaggagcggcccagc
ggcagcaagcccaaagtcaaggtaaaaacgctcaccgagtatctgcaggagaacaaggag
gcccttgagaacaacgagatgtttgctgtgtatccgctgaagacgtgcccccacttgagc
ctcctgcgacccgaggaggtgcccccatcaataaatacgggggcggcgtgcagccagtgc
gagtcgagcgaggagaactggatgtgcctcagctgtcggacggtggcctgcggtcgctat
gtgaacgagcacatgcagatgcactgcctcgagagcgagcatcccttggccatgagcctg
cgcgacttctccgtttggtgctacgcctgctcctcctacatcgaccatccccgcctctac
gccttcctcaatgctgctcacctggacaagttccgcgaaccgatggcctggacgcacgtg
tgtccccagcgcgccgacggatgctatccaattggggctgacgggagggatgaggacgat
agcgccgcaggctgcagcaacatctgcatccagctggagcgcaaccaaaacaactgaccc
ttggctatacgcgtgctggacgggatcacggactacatatgcacgctctgtcctccgctc
agacatctgctccagttcctggccgagcacctctggccaattgttgagcgtatttaccta
agcctgctgcactacttcctggcccactaa

DBGET integrated database retrieval system