KEGG   Drosophila ananassae: Dana_GF21607Help
Entry
Dana_GF21607      CDS       T01059                                 

Gene name
Dana_Mal-B2
Definition
(RefSeq) maltase B2, isoform A
Organism
dan  Drosophila ananassae
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DB_JBP1
Motif
Other DBs
NCBI-GeneID: 6504282
NCBI-ProteinID: XP_001965079
FlyBase: FBgn0098607
UniProt: B3MVE8
LinkDB All DBs
Position
Unknown
AA seq 587 aa AA seqDB search
MTIAPLIKILLFSLLLQQESGSVMSGLVKSESEDFIDWWQHTVFYQIYPRSFKDSNGDGI
GDLRGITSQLQYLADTGISATWLSPIFQSPMVDFGYDISDYKAIQPEYGTMQDFEELIDT
AYNLGIKVVLDFVPNHSSDKHEWFLKSAAKEPGYEDFYVWHDGLLQDNGTRSPPNNWQSV
FYGSAWEWHEGRQQYYLHQFTKEQPDLNFRNPKVVQAMDNVLLFWLNKGVAGFRIDAVNH
LFEDDTLQDEPLSAKTQDPLSYDYTRHIYTKDLPEVLQMVQHWRKLLDDFSAKHPKGPTR
IMMTEAYAGLTQLADYYEDVSGTKGSHLPFNFHFITDVKGDSDARDYVYNVEKWLIYMPR
GHAANWVMGNHDNPRVASRFGPASVDAMNMLLLTLPGVAVTYNGEELGMQDYREISWEDT
VDPPAKNVGEELYKEVSRDPERTPFQWNNKKNAGFSDSSKTWLPVHPNYLELNLEAQKAA
NKSHYKVYTDLIELRKSAIMRLGRFDIEPLSRWVFAFKREYPNFESIITIINVSDEEQLV
DLSEFLSQPKKLVVEICGVDSNYKYGQSLAASALLLAAREGLVCRLV
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgctcctctcatcaaaatccttctttttagtctgctgctgcaacaggaatcc
gggagcgtaatgtccggcttggtgaagagcgaatcggaggactttatcgactggtggcag
cacacggtcttctatcagatctaccctaggtccttcaaagacagcaacggcgatggcatc
ggtgatctgcgaggtatcacctcccagttgcagtatctggccgatactggcatttccgcc
acctggctgagcccaattttccagtcgcccatggtcgactttggctacgacatttcggac
tacaaggcgatccaaccggagtacggcaccatgcaggacttcgaggagctcatcgacacc
gcctataatttgggcattaaggtggtgctggactttgttccaaaccacagctcggacaag
cacgagtggttcctgaagtccgctgccaaggagccgggttacgaggacttctatgtgtgg
cacgacggactcctgcaggataacggaactcgatctccgccgaacaactggcagtccgtg
ttctacggatccgcctgggagtggcacgaggggcgacagcaatactatctgcatcagttc
accaaagagcaaccggatctgaacttccggaacccgaaagtggttcaggccatggacaac
gtgctgctcttctggctcaacaagggggtagctggctttcgcattgacgccgtgaatcac
ttgtttgaggacgacactctgcaggacgagccactgagtgccaagactcaggatccattg
tcgtacgactacaccagacacatttacaccaaggatctgcccgaggtgctgcaaatggtt
caacactggcggaaactgttggatgactttagtgccaaacacccgaaggggccgacacgc
atcatgatgacggaggcctacgccggactcacccagctggcggactactacgaggacgtg
agcgggacgaagggctcccatctgcccttcaactttcacttcatcacggatgtcaaaggg
gactcggatgcgcgtgactatgtttacaatgtggagaagtggctgatctacatgccgcgc
gggcatgcggccaactgggtcatgggcaaccacgacaatccccgcgtggcctcccgcttt
ggtcccgccagcgtggacgccatgaacatgctcctcctcaccctgcccggcgtggctgtc
acctataatggcgaggagctgggcatgcaggactaccgcgaaattagctgggaggatact
gtggatccgcctgccaaaaatgttggagaagagctatacaaggaggtctccagggatcca
gagcgaacgccgtttcagtggaataataaaaaaaatgcaggattctccgattcctcaaag
acctggcttccagttcatcccaattacctagaactgaacttggaggcccaaaaggcggcc
aacaaaagccattataaggtctacaccgatttaattgaactgaggaagtcggcaattatg
cgactgggacgatttgacatcgaacccctatcacgttgggtgtttgcctttaagcgagaa
tatcccaattttgagtcgataataaccattataaatgtaagtgacgaggagcagctggtg
gatctctcggagttcctgagccagcccaagaagttggttgtggaaatatgcggagtggac
tccaactacaaatatggccaatccctggccgctagtgcattgctcctggccgcccgcgaa
ggactcgtctgcaggctcgtctag

DBGET integrated database retrieval system