KEGG   Drosophila ananassae: Dana_GF22084Help
Entry
Dana_GF22084      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dan  Drosophila ananassae
Pathway
dan04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dan00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dana_GF22084
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dan01002]
    Dana_GF22084
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dan04147]
    Dana_GF22084
Enzymes [BR:dan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dana_GF22084
Peptidases [BR:dan01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dana_GF22084
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF22084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 6504753
NCBI-ProteinID: XP_001966292
FlyBase: FBgn0099083
UniProt: B3MY86
LinkDB All DBs
Position
Unknown
AA seq 341 aa AA seqDB search
MEMDHLPLLLSLLILPGQTHPEMENAGTLQTTEPIVSLPPEMSLTLSSPSSSSFVILPKV
VGGYAVTINQVPYQVSIRRRSIHEKQYGLGHVCGGTIISQRVVCSAAHCFAINSTGLPLE
YREPELFVVVAGSSAIDQTDRFTQEYLVRRIIGHEQYNSSTLENDIALIFIDGYIPWESQ
GAQALPLATEAPVEGTICLIHGWGKVSANDKSSTLQQAPVPILKKSLCNIIYKLPESQLC
AGFLQGGIDACQGDSGGPLVCSGRLAGIISWGVGCADPGYPGVYTNVSHFLEWIRIANSS
LDYSEYGDRSLQSCGPCSWIGPAFWLLLSVLMILPHGLMGL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaccacctgccgctgctgctgtcgctcctgatcctgcccggccagactcac
ccggaaatggagaacgccggaacgcttcagacaacggaaccaatcgtcagcctaccgccg
gaaatgtcacttactttgtccagtccatcgtcgtcgtcctttgtcatcctgccgaaggtg
gtcggcggctatgcggtgaccattaatcaggtaccctaccaggtctccatacgacggcgt
tccatccacgagaagcagtacggcttgggtcatgtgtgcggcggaacgatcatatcccag
cgggttgtctgctcggcagctcattgtttcgccataaactcaactggcctgccgctggag
taccgggaaccggaactgttcgtcgtggtggccgggagcagtgccatcgatcagacggat
cgcttcacccaggagtatctggtgcgccggattatcggccacgagcagtacaattccagc
accttggagaacgacatcgccctgatcttcatcgatggctatataccgtgggagtcgcag
ggtgcccaggccctgccactggccaccgaagcgcccgtcgagggaaccatctgcctcatt
cacggctggggcaaggtcagtgcgaacgacaagtcctcgacgctacaacaggccccagtg
ccgatattgaagaagagcctctgcaacatcatctacaagctgccggagtcgcagttgtgc
gccggattcctgcagggcgggatcgatgcctgccagggcgactccggaggaccgcttgtc
tgctccggccgactggccggtatcatctcatggggcgtcgggtgtgctgatcccggctat
ccgggtgtttacacgaatgtctcgcactttctcgagtggatccgtatcgccaattcctca
cttgattattccgagtacggggataggtccctgcaaagttgtggtccttgttcctggata
ggtcctgccttctggctgctgctgagtgtccttatgatccttccgcatggacttatgggc
ctgtag

DBGET integrated database retrieval system