KEGG   Drosophila ananassae: Dana_GF22320Help
Entry
Dana_GF22320      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dan  Drosophila ananassae
Pathway
dan00010  Glycolysis / Gluconeogenesis
dan00051  Fructose and mannose metabolism
dan00052  Galactose metabolism
dan00500  Starch and sucrose metabolism
dan00520  Amino sugar and nucleotide sugar metabolism
dan01100  Metabolic pathways
dan01200  Carbon metabolism
Module
dan_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dan_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF22320
   00051 Fructose and mannose metabolism
    Dana_GF22320
   00052 Galactose metabolism
    Dana_GF22320
   00500 Starch and sucrose metabolism
    Dana_GF22320
   00520 Amino sugar and nucleotide sugar metabolism
    Dana_GF22320
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dana_GF22320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dan04131]
    Dana_GF22320
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dana_GF22320
Membrane trafficking [BR:dan04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dana_GF22320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 EloA-BP1
Motif
Other DBs
NCBI-GeneID: 6504984
NCBI-ProteinID: XP_001965688
FlyBase: FBgn0099318
UniProt: B3MW58
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MDRELNGAMRSVSINSNGTAQLNGHSRDETDRVGGVPGGVVTATAAAAAASQTTTKCSST
ANANATAATNAAIALEANLFAAASASEKKKMVHELCQQLLLTDEQVQELCYRILHELRRG
LAKDTHPKANVKCFVTYVQDLPNGNERGKFLALDLGGTNFRVLLIHLQENNDFQMESRIY
AIPQHIMIGSGTQLFDHIAECLSNFMAEHNVYQERLPLGFTFSFPLRQLGLTKGLLETWT
KGFNCAGVVNEDVVQLLKDAIARRGDVQIDVCAILNDTTGTLMSCAWKNHNCKIGLIVGT
GANACYMERVEEAELFDVEADNKKPHVLINTEWGAFGDNGALDFVRTEFDRDIDVHSINP
GKQTFEKMISGMYMGELVRLVLVKMTHAGILFNGQDSEVLNTRGLFFTKYVSEIEADEPG
TFTNCRLVLEELGLTNATDGDCANVRYICECVSKRAAHLVSAGIATLINKMDEPHVTVGV
DGSVYRFHPKFHNLMVEKISKLIKPGITFDLMLSEDGSGRGAALVAAVACREDMLSPKK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggatcgggagctgaacggcgctatgaggagtgtgtctataaatagcaacggtaccgca
cagctgaacggacacagtcgcgacgaaacggatcgagtgggtggtgtaccggggggtgtg
gtaacagcgacagcggcggcagcggcagcatcacagaccaccacaaaatgcagctcgacg
gcgaacgcaaatgcaacagcggccacaaatgcagcgatagcgttggaggcgaaccttttt
gcggccgctagcgcatcagagaaaaagaagatggtgcacgagttatgtcagcagctgctg
ctaacggacgagcaggtgcaggagctgtgctatcgcatcctccacgagctgcgacgcggc
ctcgccaaggacacccatccgaaggccaatgtcaagtgctttgttacgtacgtgcaggac
ctgcccaacggcaatgagcgcggcaagttcctcgccctcgatctcggcggcaccaatttc
cgggtgctcttgatccacctgcaggagaacaacgacttccaaatggagtcccgcatctat
gccataccccagcacatcatgattggctcgggcacccagctgttcgatcacatagccgag
tgcctctccaattttatggcggagcacaatgtctatcaggagcgattgcccctcggcttc
accttctcgttcccgctgcgccagctgggcctcaccaagggcctgctggagacctggacc
aagggcttcaactgtgccggtgtcgtcaacgaggatgttgtccagctgctaaaagacgcc
atcgcccggcgcggcgacgtccagatcgatgtgtgcgccatcctgaacgacaccaccggc
accctgatgagctgcgcctggaagaatcacaactgcaagatcggcctgatcgtcggcacc
ggcgccaatgcctgctacatggagcgcgtggaggaggcggaactcttcgacgtcgaggcg
gacaacaagaagccccatgtcctgatcaacaccgagtggggcgccttcggcgataatggt
gccctcgactttgtccgcaccgagttcgatcgcgacatcgacgtgcacagcatcaatccc
ggcaagcagaccttcgagaaaatgatctccggcatgtacatgggcgagctggtgcgtctc
gttctcgtcaagatgacccatgccggtatactgttcaacggccaggactcggaggtcctc
aacacccggggcctcttcttcaccaagtatgtgagcgagatcgaggccgatgagcccggc
accttcaccaactgccggctggtcctcgaggagctcggcctgaccaacgccaccgacggt
gactgcgccaacgtccgctacatctgcgagtgcgtctcgaagcgggccgcccacctggtg
tccgccggcatcgccaccctcatcaacaagatggacgagccgcacgtgaccgtgggcgtt
gacggcagcgtgtatcggttccatcccaagttccacaacctgatggtcgagaagatctcg
aagctgatcaagccgggcatcacgttcgatctgatgctctcggaggacggatcgggccga
ggtgcggcgctggtggcggcggtcgcctgtcgcgaggacatgctctcgcccaaaaagtag

DBGET integrated database retrieval system