KEGG   Drosophila ananassae: Dana_GF24501Help
Entry
Dana_GF24501      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dan  Drosophila ananassae
Pathway
dan00020  Citrate cycle (TCA cycle)
dan00190  Oxidative phosphorylation
dan01100  Metabolic pathways
dan01200  Carbon metabolism
Module
dan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dan_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dana_GF24501
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dana_GF24501
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dana_GF24501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO HI0933_like FAD_binding_3 GIDA Caps_synth
Motif
Other DBs
NCBI-GeneID: 6507133
NCBI-ProteinID: XP_001956613
FlyBase: FBgn0101495
UniProt: B3M4M0
LinkDB All DBs
Position
Unknown
AA seq 645 aa AA seqDB search
MNRIFAKRAVQPLGRCIIPSASRLFSAGCPKDEYAMQDHNYDAIVIGAGGAGLRAALGLG
EKGFKTAIISKLFPTRSHTVAAQGGVNAALSNMDEDDWKFHFYDTVKGSDWLGDQNAIHY
MCKEAPKAIYELDAYGVPFSRKEDGKIYQRPFGGQTLGYGKGGVARRACAVADRTGHSLI
HTMYGQTLKYADVCHYFIDYFVLDLIMEYGCCVGCVAWKLDDGTFHRFLARNTVVAAGGC
GRVYFSTTAGHTCTGDGNAWVSRQELPLMDMEFVQFHPTGIYGAGCLITEGVRGEGGFFL
NCKGERFMERYAPKAKDLASRDVVARAMTMEVLAGNGCGPLKDHVHLQLHHIDPQIIRTR
LPGIMVTAKIFAKVDVMKEPVPVLPTVHYNMGGVPTDFKGRVLTIDGDGKDVVVKGLYSC
GETSCASVHGANRLGANSLLDLIIFGRVCAEDIVKNNCPGEEPPCPDEKFTTRTMDNFKK
LRCADGVVTTAELRDELQRAMTRHAAVFREGKLLKEGLLKIAELCEKFKCIKVHDRTLVW
NTNLIETLELQNMLVNAVHIISAMENREESRGSHAREDFKTRIDELDYSIPLAGQRKKAM
DDHWRKHTLTFSEPGKGCATIKYRPVIDTTLDDSVASIPPAPRTY
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcattttcgccaaacgggctgtccaacctctcggtcgctgcattattccatcg
gctagtcgcctcttcagcgcaggatgtcctaaggacgagtatgccatgcaggaccacaac
tacgatgcgattgtgatcggagccgggggagcgggattgcgggcggcgttggggctgggg
gagaagggattcaaaacggcgataatatcgaagctctttcccacacgctcccacacagtg
gccgcccagggcggcgtgaatgctgctctttcgaatatggatgaggacgattggaagttc
cacttctacgacacggtcaagggcagtgactggttgggggaccagaacgccatccactat
atgtgcaaggaggcgccgaaggccatctacgagctggacgcctacggcgtgcctttctcc
cgaaaggaagatggcaagatctaccagcggcctttcgggggtcagactctgggctatgga
aagggcggagtagcccgtagagcctgcgccgtcgccgatcgcacgggtcattcgctcatc
cacaccatgtatggtcagaccctgaagtatgccgatgtctgccattactttatagactac
ttcgtcctggacttgatcatggagtacggctgctgtgtgggctgtgtggcctggaaactg
gatgacggaacctttcatcgcttcctggccaggaacactgtggtagccgccggtggctgt
ggccgcgtctacttctccaccacagccggacacacgtgcacgggtgatggcaacgcctgg
gtgtcgcgccaggagctccctctcatggacatggaattcgttcagttccatcccaccggt
atttatggagccggttgcctaatcaccgagggtgtccgcggtgagggcggattcttcctc
aactgcaagggagaacgctttatggagcgttatgctcccaaggccaaggatctggcttct
agggacgtggtggctcgcgccatgacgatggaagtgttggccggcaacggctgtggtcct
ctcaaggaccatgttcacttgcagctgcatcacatcgatccgcagatcatcagaacgagg
ctaccgggcattatggtcaccgcgaagattttcgccaaggtggacgtgatgaaggaaccg
gtgcccgtgctgcccaccgtgcactacaacatgggcggcgtacccacagactttaagggc
cgggtgctaaccatcgacggggatggcaaggatgtggtcgtcaagggcctctactcctgc
ggcgagacgtcctgtgcctcggtgcatggagcgaaccgtttgggtgccaactcgttgctc
gacttgatcatcttcgggcgcgtctgcgccgaggatattgtcaagaacaactgtccgggg
gaggagccaccgtgtccggacgaaaagttcacaacccgaaccatggacaactttaagaag
ctgcggtgtgccgacggcgttgtaactaccgcagaactacgggatgagctgcagagagcg
atgactagacacgcggctgtattccgggaagggaaactcctcaaagagggtcttttgaaa
atcgccgaactgtgtgaaaagtttaagtgcatcaaggttcacgatcgcaccctggtctgg
aacacgaatctcatcgagaccttggagctgcagaatatgctggtgaatgcggtgcacatc
atttccgccatggaaaatcgcgaggagtccaggggatcacacgctcgtgaggacttcaag
acgcgaatcgacgagctggactactcgattcctttggccggtcagcggaagaaggccatg
gacgaccattggcggaagcacactctcacattttccgagcccggcaagggctgtgctaca
atcaagtaccgaccagttatagacacgacactagacgactctgtggcttccattcctccg
gctccgcgcacctactga

DBGET integrated database retrieval system