KEGG   Drosophila ananassae: Dana_GF24570Help
Entry
Dana_GF24570      CDS       T01059                                 

Gene name
Dana_Sod1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dan  Drosophila ananassae
Pathway
dan04146  Peroxisome
dan04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dan00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dana_GF24570 (Dana_Sod1)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dana_GF24570 (Dana_Sod1)
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dana_GF24570 (Dana_Sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 6507202
NCBI-ProteinID: XP_001956494
FlyBase: FBgn0101564
UniProt: B3M3W6
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MVVKAVCVLNGDAKGTVFFEQESSDAPVKVTGEVCGLGKGLHGFHVHEFGDNTNGCMSSG
PHFNPYGKEHGAPGDENRHLGDLGNIEATGDCPTKVTISDSKITLFGADSIIGRTVVVHA
DADDLGKGGHELSKSTGNAGARIGCGVIGIAKI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggttgttaaagcagtttgcgttctcaatggcgatgccaagggcacagttttcttcgag
caggagagcagcgacgctcccgtgaaggtcaccggagaggtgtgcggcctgggcaagggt
ctgcacggcttccatgtgcacgagttcggagacaacaccaacggctgcatgtcctccggc
ccccatttcaacccctacggcaaggagcacggcgctcccggcgatgagaaccgtcacttg
ggcgacttgggcaacatcgaggctactggcgactgccccaccaaggtcaccatcagcgac
tccaagatcactctctttggcgccgatagcatcattggacgcaccgtggttgtccacgcc
gatgccgacgacttgggcaagggcggacacgagctgagcaagtccaccggcaatgctggt
gcccgaattggatgcggagtgattggaattgccaagatctaa

DBGET integrated database retrieval system