KEGG   Drosophila ananassae: Dana_GF27675Help
Entry
Dana_GF27675      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
dan  Drosophila ananassae
Pathway
dan00500  Starch and sucrose metabolism
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dana_GF27675
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dana_GF27675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 26515084
NCBI-ProteinID: XP_014764086
FlyBase: FBgn0274898
UniProt: Q23834 A0A0P8Y7C4
LinkDB All DBs
Position
Unknown
AA seq 495 aa AA seqDB search
MRGLTKSLVCLALLAVANAQFNTNYASGRSGMVHLFEWKWDDIASECENFLGPNGFAGVQ
VSPVNENAVKDSRPWWERYQPISYKLVTRSGNEEQFASMVRRCNNAGVRIYVDVVFNHMA
ADGGTYGTGGSTASPSSKSYPGVPYSSLDFNPTCAISNYNDANQVRNCELVGLRDLNQGN
SYVQEKVAEFLNHLIDLGVAGFRVDAAKHMWPADLGTIYGRLKTLNTDHGFQSGAKAYIV
QEVIDMGGEAISKSEYTGLGAITEFRHSDSIGKVFRGKNQLKYLTNWGTAWGFAASDRSL
VFVDNHDNQRGHGAGGADVLTYKVAKQYKMASAFMLAHPFGTPRVMSSFSFSDTDQGPPT
TDGHNIASPVFNSDNSCSGGWVCEHRWRQIYNMVAFRNTVGSDEIQNWWDNGSNQIAFSR
GGKGFVAFNNDNYDLNSSLQTGLPAGTYCDVISGMKNGSSCTGKTVTVGSDGRANISIGS
SEDDGVLAIHVSAKL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaggggtctgaccaagagccttgtatgcctcgccctcctggcggtggccaacgcccaa
ttcaataccaactatgcgtcaggccgcagcggtatggtgcacctcttcgagtggaagtgg
gatgatattgcatctgaatgcgaaaacttcttgggcccgaacggatttgccggtgtccag
gtatcacccgttaatgaaaatgccgtaaaggatagtcgtccctggtgggaacgttaccaa
cccatctcatacaaacttgttactcgttccggaaatgaagaacaattcgcctctatggtc
agacgttgtaacaacgctggagtccgcatctacgtggacgtcgtttttaaccacatggcg
gccgatggtggcacttatggcactggtggcagcactgccagtcccagcagcaagagctac
cccggtgtgccctactcttcgctagacttcaatccgacctgtgccatctccaactataac
gacgctaaccaagtgcgtaactgcgagctggtgggtctccgcgatttgaaccaaggaaat
tcgtatgttcaagagaaggttgccgaattcctgaaccaccttatcgacctcggtgtggct
ggattccgtgtggatgccgccaaacacatgtggcctgcggacttgggcaccatatacggc
cgcctcaagaccctgaacacggatcatggtttccagtctggtgccaaggcctacattgtc
caggaagtgatcgatatgggtggcgaagccattagcaagtctgagtacaccggcttggga
gccattaccgagttccgccattccgactctatcggtaaagttttccgcggcaagaaccag
ctgaagtatctgaccaactggggaaccgcctggggcttcgcagcctccgaccgatcgctc
gtctttgttgacaatcatgacaaccagcgcggtcacggggccggtggtgccgatgtgctc
acctacaaggtggccaagcaatacaagatggcctctgcgtttatgttggcccatcccttt
ggcactcctcgtgtcatgtcgtcgttctcattttcagacacagaccagggtccacccact
accgacggccacaacatcgcgtctccggttttcaacagcgacaattcttgcagcggtggc
tgggtgtgcgagcaccgttggcgccagatctacaacatggttgccttccgaaacaccgtt
ggctctgacgaaatccagaactggtgggacaatggcagcaaccagatcgcattcagccgt
ggtggcaagggcttcgtagccttcaacaacgataactacgacctcaatagctcccttcag
acgggtctccccgccggtacctactgtgacgttatttcaggcatgaaaaacggttcctcc
tgcaccggcaaaaccgttacagtcggatctgacggcagagctaatatctcgatcggcagc
tcagaagacgatggtgtactggccattcatgtcagcgccaagttgtaa

DBGET integrated database retrieval system