KEGG   Desulfobacca acetoxidans: Desac_0603Help
Entry
Desac_0603        CDS       T01454                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
dao  Desulfobacca acetoxidans
Pathway
dao00550  Peptidoglycan biosynthesis
dao01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dao00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desac_0603
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Desac_0603
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dao01011]
    Desac_0603
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dao03036]
    Desac_0603
Enzymes [BR:dao01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Desac_0603
Peptidoglycan biosynthesis and degradation proteins [BR:dao01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Desac_0603
Chromosome and associated proteins [BR:dao03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    Desac_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer PASTA
Motif
Other DBs
NCBI-ProteinID: AEB08489
UniProt: F2NG76
LinkDB All DBs
Position
complement(714368..716428)
Genome map
AA seq 686 aa AA seqDB search
MLGKWIRVRIILVGLGLGIFFLAVFCRIVELKFIRGPALEEMAVREHEKHCPVLPIRGSI
MDRNQAELAISTFVKSLGAHPRRLTEKKLLSRKLAPLIGIPAPQLLELLARDRPFIWVKR
HLTPQQTEAVENFKANYEKINLGQEKNIDSKDASLDAMYLIPEARRYYPHQSLAGPILGF
CDIDGRGLEGLERQFDEYIYGKPQKCINILDARGHIVISSEKELIDDTMGDNIILSIDRT
IQYIAEKELQQGVNKWHAAGGYVVVAAPQTGEILAMAQIPGFDPNHYFQYTKEHYQNRNV
TMALEPGSTFKIFTVAAALDAKVVKPMDKFHCENGAYSLGACGVIHDVHPYGGLTVSEII
KKSSNIGAAKIGLKLGPHRTAHYLKGFGFGQRTGICYSGENYGLVRNITSCRSLIDRVTV
SFGQGITITPLQMTMALAALGNDGILMQPLLVKKIIDHKGETVKNFHPTAVRQVLSPQTA
KTMLDMMKTATEPGGTGTEAVPPGYTVAGKTGTAQKVVGRAFSKSKYNSLFVGLTPAENP
VLAIVVVIDEPKGAIYGGVVAAPIFREIAAQSLRFLGYYPQQHPPTTPTSPPLKSPKPPL
KETPTPTPEPLPTVQASLTSIPLETDSLQQMPNFKGMTIRQVISLLNRAGMRYRIEGRGF
AVEQRPAPGEPLPSDKFCWVKFKPQS
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgcttggcaagtggatacgtgtccgcataattctcgtgggcttggggttgggtattttc
ttcctggcggtgttctgtcggattgtagaattaaaattcatccgaggcccggccctagaa
gagatggcggtgcgagaacatgagaagcactgtcccgtcctacctattcggggctcgata
atggatcgcaaccaggcggaacttgccatcagcacctttgtaaaatccctgggagcacac
ccgcgccgtcttactgaaaagaaactgcttagtagaaagcttgctcctcttatcggtata
ccagcgcctcaattacttgagcttttagcaagagaccggccgtttatctgggttaaacgc
cacctgacgccacaacagaccgaagcagtggaaaactttaaagccaactatgagaaaata
aatttaggtcaggaaaagaatattgacagcaaagatgccagtctagacgccatgtatctg
attccggaggcacgacgctattatccccaccagtctctggccggaccgatcctcggattc
tgtgacattgacggacgcggtttggaaggtttggaacgccagttcgatgagtatatttat
ggcaaaccgcagaagtgcattaacatactggacgcccgcggtcatatcgttatctcgagc
gaaaaagaattaatcgatgacactatgggcgacaacataatcctcagcatcgatcgaacg
attcaatatattgcagagaaagaattacagcaaggggtcaataagtggcatgccgccggt
ggttatgtcgtggtagccgcgcctcagaccggggaaatcctggccatggcccagatccca
ggctttgatccaaatcactattttcaatatactaaagaacactatcagaatcgcaatgta
acgatggcccttgaacccggttcaacttttaaaatctttactgtggcggcggccttggat
gccaaggtggtaaagcccatggataaattccactgcgagaacggcgcctatagtctgggg
gcatgcggagtgatccatgacgttcatccttacggcggccttactgtcagtgaaataatc
aagaaatcgagcaacatcggagccgccaagataggtctcaagcttggcccgcaccgaacg
gcgcattatttaaagggcttcggcttcggtcagcggactggaatctgttattcgggagaa
aattacggtctggtgcgcaatatcacctcctgccggtccctgattgatcgggtcaccgtc
tccttcggccagggcatcactatcacaccgctgcagatgaccatggcgctggcggcgttg
ggcaacgacggcatccttatgcagcccttgcttgttaaaaaaattatcgatcataagggg
gaaaccgtcaaaaatttccaccccaccgcagttcgccaggtactatccccccagaccgcg
aaaacaatgctggacatgatgaagaccgcaactgaaccgggcggaacggggaccgaggcg
gtaccgccaggctacaccgtagctggcaagacgggcacggcccaaaaagtggtaggccgg
gccttttccaaaagcaagtacaattctttgtttgtcggattaacgccggccgaaaacccc
gtcttggccattgtggtggtcatcgatgaaccaaaaggggcgatttacggcggtgtggtg
gccgcacccatctttcgggaaattgccgcccaatcgctgagatttttgggttattacccc
caacagcacccccccaccaccccgacttcgcctccgcttaagtcgccgaaaccacctttg
aaagagactccgaccccgacgcccgaaccattgccgacggtgcaggccagcctgacaagc
attccgctagaaaccgattctctccagcagatgccgaattttaagggtatgaccatccgc
caggttatctctctgctcaaccgggcgggaatgcgttatcggatcgaaggccggggcttc
gcggtggaacagcggccggcacccggagagccgctgccatcagataaattctgttgggtg
aaatttaaaccccagtcctga

DBGET integrated database retrieval system