KEGG   Denitrovibrio acetiphilus: Dacet_0803Help
Entry
Dacet_0803        CDS       T01189                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap00473  D-Alanine metabolism
dap00550  Peptidoglycan biosynthesis
dap01100  Metabolic pathways
dap01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Dacet_0803
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dacet_0803
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Dacet_0803
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dap01011]
    Dacet_0803
Enzymes [BR:dap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Dacet_0803
Peptidoglycan biosynthesis and degradation proteins [BR:dap01011]
 Precursor biosynthesis
  Amino acid ligase
   Dacet_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C GARS_A CPSase_L_D2 zf-CDGSH ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADD67583
UniProt: D4H5G3
LinkDB All DBs
Position
825917..826927
Genome map
AA seq 336 aa AA seqDB search
MEMPMNIGLVYDLRSDYLKMGFSEEDTAEFDSEETISAIETALCECGHSVERIGNYFALH
KKLAAQKSWDLVFNIAEGLYGMGRESLVPCVLDAYGINYTFSDPLAISLTLHKGMAKHIL
KGCGVATADFAVVNNLGDIDSINLGFPLFAKPAAEGTGKGISDRSIVWNSADLKRVCTEL
LVRYSQPVLVEKLLEGREFTVGIIGSGSEAVSVGVMEILPRNKEGIFVYSYENKENCESL
LDYSLVYGDTADRCADVALRAYRALGCRDAGRVDVRLDGDGIANVIELNPLPGLHPTHSD
LPMIWTKAGMSYRQLICSIAAKAKARVEHIQESKAI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcctatgaatattggtctcgtttatgacctccgcagcgactaccttaaaatg
ggattcagtgaggaggatacagcagagtttgacagtgaggaaacgatatcagctatagag
acagctctctgcgaatgcgggcacagtgttgagcgtatagggaactattttgctcttcat
aagaagctcgcagcgcagaagagctgggatcttgtgtttaacattgcagaggggctttac
ggcatggggcgggagtctctcgtaccatgtgttctggatgcttacggtatcaactatacc
ttttcggatccgcttgcgatcagccttaccctgcataaggggatggcaaagcatatcctg
aaagggtgcggggttgccactgctgacttcgctgtggttaataatctaggcgatatcgat
agtataaaccttggttttccgttgtttgcaaagcccgcagcggaaggcacaggcaaaggg
attagcgacaggtcgatagtctggaacagcgcagacctgaaaagagtttgtactgagctt
cttgtaagatacagtcagcctgtgcttgttgaaaaactgctcgaaggacgtgagtttaca
gtggggataataggatccggcagtgaagctgtgagcgttggtgttatggaaatattgccg
agaaacaaagaaggaatattcgtttattcctatgagaacaaagagaattgtgaatctctt
ctggactatagtcttgtttacggtgatacagcagacaggtgtgcagatgttgcccttaga
gcatacagagcactggggtgcagagacgcagggcgtgttgacgtcaggcttgacggtgac
ggaatagcaaatgttatagagcttaaccctctgccggggctgcatccgacacattcagat
ttgcctatgatatggactaaggccggcatgtcctacagacagctaatatgcagcattgca
gcaaaggcgaaggccagagttgagcatatacaggagagtaaagcgatatga

DBGET integrated database retrieval system