KEGG   Dickeya aquatica: DAQ1742_01984Help
Entry
DAQ1742_01984     CDS       T06021                                 

Gene name
yejG
Definition
(GenBank) FIG00896318: hypothetical protein
Organism
daq  Dickeya aquatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YejG DUF2714
Motif
Other DBs
NCBI-ProteinID: SLM62912
UniProt: A0A375A9W3
LinkDB All DBs
Position
2005178..2005489
Genome map
AA seq 103 aa AA seqDB search
MPQSYRWLSGFAGVKVEPLPLSNHDDDSHLIGFKLLSHDGEQARQIMRHLNQSLDEIQLQ
CAVVEWEGEPCLFLHRQDESAAMCRLKDVGVAIAESVRAHYPF
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcaaagttatcgctggttatccgggtttgctggcgtaaaagttgaaccacttccg
ctaagcaatcacgatgatgacagccatctgatcggttttaagcttctcagtcatgatggt
gaacaagcacgacagattatgcggcatttaaatcagtcactggatgaaattcagcttcag
tgtgcggttgtggagtgggaaggcgagccttgcctgtttttacatcgccaggatgaaagt
gcggcgatgtgccgcctgaaagacgttggcgtggcgatagccgagtcggttcgcgcacac
tatccgttttaa

DBGET integrated database retrieval system