KEGG   Dickeya aquatica: DAQ1742_01988Help
Entry
DAQ1742_01988     CDS       T06021                                 

Gene name
yejA
Definition
(GenBank) Microcin C transporter YejABEF, periplasmic binding protein; ABC family; regulated by rydC sRNA
  KO
K13893  microcin C transport system substrate-binding protein
Organism
daq  Dickeya aquatica
Pathway
daq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:daq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DAQ1742_01988 (yejA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:daq02000]
    DAQ1742_01988 (yejA)
Transporters [BR:daq02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Microcin C transporter
    DAQ1742_01988 (yejA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: SLM62916
UniProt: A0A375AAI6
LinkDB All DBs
Position
complement(2009374..2011185)
Genome map
AA seq 603 aa AA seqDB search
MFIRVLIAIALLASGWLAHAAPITHQAYAFATLGTPKYTEGFEHYDYANPTAPKGGKITL
SALGTFDNFNRYALRGLAAARSESLYDALYVSSEDEPGSYYPLIARHARYASDYSWVEVD
MNPDARFHDGSPITAADVAFTFNLFMTQGVPQFRVYYKGSQASATAPLTVRFSFAEPDKE
KMLGILTLPVMPEKFWRDHKLSDPLSTPPLASGPYRISDYRLGQYVVYRRQPDYWAADLP
VNRGRYNFDQIRYDYYLDDSVALEAFKAGAFDMRAEGSPKQWATQYEGGNIARGYIVKRD
ELNQAAQDTRWLVFNTQRPLFGDRRVRQAIALAFDFDWMNNALFFNSYQRPASFFQNTEY
AAKGEPSGEELRWLMPLKDKLPADVFGPAYRPATTDGSGYDRTHRQQALALLQQAGWELK
NQVLVNKQTGQPFRFELLLPGAANAIYVLPFQQSLARLGIRMEVRSVDSPQFNNRFRKRD
FDMIPKLYPAMPYPSADLAISWSSAYLNSSYNSPGVQDPAIDTLIDEIIRHQGDKPALLA
LGPALDRVLTWHQFAIPMWYSGHERFAYWNKFAMPAVRPAYSLGMDSWWYDTDNAARLPA
ARR
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtttatacgtgttcttattgccatcgcgctgctagcgagcggctggctggctcacgcc
gccccgataacgcatcaggcctatgcgtttgccacccttggcacaccaaagtacaccgaa
ggatttgagcactatgattacgccaatcccacggctcccaaagggggaaaaatcaccctg
agtgcgctcgggacgtttgataatttcaaccgttacgcgttacgtggactggcggccgca
cgttcagaaagcctgtatgacgcgctgtatgtcagctccgaagatgagcctggcagctac
tacccgcttatcgcacgccacgcgcgctatgccagtgactacagttgggtcgaagtggac
atgaaccctgatgcgcgttttcatgacggctcaccgattaccgcagccgatgtggccttc
acctttaacctgttcatgacccaaggcgtaccgcaatttcgcgtgtactacaaaggctct
caagccagcgcaaccgcaccattgacggtacgctttagtttcgccgaacccgataaagaa
aaaatgctcggcattttaacgctgccggtgatgccagaaaaattctggcgtgaccataaa
ctgagtgacccgctcagtaccccgccattggccagtggcccatatcgcatcagcgattat
cgtctggggcaatatgtggtttatcgccgtcagcccgattattgggccgccgatttaccg
gtcaaccgcggacgttataactttgaccagattcgttacgattactacctggatgacagc
gtcgcgctggaagccttcaaggccggagcctttgatatgcgcgcagaaggctcacccaaa
cagtgggctacacaatacgaaggcggcaatatcgcccgtggctatatcgtcaaacgcgat
gagctcaatcaggcggcacaggatacccgctggctggtttttaacacccaacgcccgctg
tttggcgaccgccgggtgcgccaggcgattgcgctggcctttgactttgactggatgaat
aacgcgttattctttaatagctatcagcgtcctgccagcttttttcagaacaccgaatat
gccgcaaaaggtgagccttctggcgaagagttgcgctggctgatgccgctaaaagataag
ctccccgccgacgtgtttggcccggcctatcgcccggccaccaccgatggcagcggctat
gaccgaacccaccggcaacaggcgctggcgctgctgcaacaggctggctgggagttgaaa
aatcaggtgttggttaataagcaaaccggccagccgtttcgcttcgagttattgctgccg
ggtgcggccaatgccatctatgtattgccatttcagcaaagcctggctcggctgggcatt
cgtatggaggtacgcagtgtcgatagcccacagttcaataaccgctttcgcaaacgcgat
ttcgatatgatccccaagctctaccctgccatgccttaccccagtgctgacttggccatt
agctggagttcagcctacctcaactcatcctataactcgccgggagtacaagacccggcg
attgatacactcatcgatgaaattatccgccatcagggagataagcccgcgctactggcg
ctcggccctgcacttgaccgggtattgacctggcatcagttcgccatacccatgtggtac
tccgggcacgaacgctttgcctactggaacaaatttgccatgcccgccgtgcggcccgcc
tactcgctgggtatggacagttggtggtacgacaccgataacgctgcccgcctgcctgcg
gcacgtcgctaa

DBGET integrated database retrieval system