KEGG   Dickeya aquatica: DAQ1742_03641Help
Entry
DAQ1742_03641     CDS       T06021                                 

Gene name
lysR
Definition
(GenBank) Transcriptional activator protein LysR
Organism
daq  Dickeya aquatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_23 HTH_28 HTH_30 HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID: SLM64436
UniProt: A0A375AEV4
LinkDB All DBs
Position
3655568..3656503
Genome map
AA seq 311 aa AA seqDB search
MANISLRHIEIFHAVMTTGNLTEAAALLNTSQPTVSRELARFEHLVQMPLFERIRGRLHP
TAQGLQLFEEVQHSYYGLERIINAAQDIRQFRQAPLSVACLPVFSQSLLPEVCQPLLARY
PELNLHVIPQESPLLEEWLSAQRHDLGLTENLNTPAGTGRQTLMELNEVCVLPIGHPLAG
KTVLTPEDFRDQPFVSLSMTDSYRQLLDQQFEQANVTRRLVLDTHSAASVCAMVRAGVGL
SIVNPLTAVDYASSGAVVMRRFSIDVPFTVSLIRPLHRPASALVAQFTEQLLIFAEHFPA
RLQRWLTASPV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccaatatttccctgcgccacatcgagatttttcacgcggtgatgaccaccggcaac
ctgacggaagcagcggcgctgctcaacacctcgcagcccaccgtgagccgcgaactggcg
cgcttcgagcatctggtgcagatgccgctgttcgagcgcattcgcgggcggctgcacccc
accgcgcaagggttacagctgtttgaggaagtgcagcactcttattacgggctggagcgc
atcatcaacgccgcacaggatatccgccagttcaggcaggccccgctctcggtagcttgc
ctgccggtgttctcccagtcgttattgcccgaggtgtgccagccactgctggcacgctac
cccgaactcaacctgcacgtcatcccacaggaatcaccgctgctggaagagtggttgtcg
gcacagcgccacgatctggggctaacggaaaatctgaatacgcccgcaggcaccgggcgg
caaacgctgatggaattaaacgaagtctgcgtgctgcccatcggccacccgctggcaggc
aaaacggtgctgacaccggaggatttccgcgaccagcccttcgtcagcctatccatgacc
gacagttaccggcaattgctcgaccagcagtttgaacaggcgaatgtcacgcggcggctg
gtgctcgatacccatagcgccgcctcggtgtgcgcgatggtgcgcgccggggtaggatta
tcgatagtcaatccgctaacggcggtggattacgccagcagcggtgcggtggtgatgcgg
cgattcagcatcgatgtgccctttaccgtcagcctgattcgtccgttacaccgcccggcc
tcggcgctggtggcgcaattcaccgaacagttactcatcttcgccgaacattttcccgca
cggttacagcgctggctgacggcctcgcccgtctaa

DBGET integrated database retrieval system