KEGG   Dechloromonas aromatica: Daro_0118Help
Entry
Daro_0118         CDS       T00259                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dar  Dechloromonas aromatica
Pathway
dar00970  Aminoacyl-tRNA biosynthesis
dar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Daro_0118
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dar03029]
    Daro_0118
Enzymes [BR:dar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Daro_0118
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Daro_0118
Mitochondrial biogenesis [BR:dar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Daro_0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AAZ44877
UniProt: Q47JV4
LinkDB All DBs
Position
134341..135798
Genome map
AA seq 485 aa AA seqDB search
MINASLKELSLALAAKKVSSVELSSLFLDRIERLNPTLNAFVTVDREKSLQMARDADARI
AAGTAGPLTGIPIAQKDIFCAEGWLSTCGSKMLANFVSPYDATVIRKMHAEAGLVSLGKT
NMDEFAMGSSNETSFFGSVRNPWDTQRVPGGSSGGSAAAVAARLAPAATGTDTGGSIRQP
AALCNLTGLKPTYGVVSRYGMIAFASSLDQGGPMAASAEDCALLLNTMVGFDERDSTSLE
RPVEDYARDLDKPLDGLRIGLPKEFFGEGCDAEVMAAVRAAIAEYEKLGATCVEISLPNS
HLSVPAYYVIAPAEASSNLSRFDGVRYGYRAPEYGNLDDMYMKTRAQGFGAEVKRRILIG
AYVLSHGYYDAYYLQAQRIRRLIANDFVEAFKHCDVIMSPTSPSTAFKLGEKAADPVQMY
LSDIYTIAVNLAGLPGMSIPCGFVGGLPVGLQLIGNYFAENRLLNVAHRYQQATDWHQRR
PGGIE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgccagcctgaaagaattgtcgctggccttggccgcgaagaaggtttccagc
gtcgaattgtcgtcgttgttcctcgatcgcatcgagcgtctgaatccgactctgaatgcc
ttcgtgacggttgatcgcgagaaaagcctgcaaatggcccgcgacgcggatgcgcgcatc
gctgccggcacggccggcccattgaccggcattcccatcgcccagaaggatatcttctgc
gccgagggctggctgagcacctgcggctccaaaatgctggccaacttcgtctcgccctac
gatgcgacggtcatccgcaagatgcacgccgaagccggattggtgtcgctcggcaagacg
aacatggacgaattcgccatgggttcgtcgaatgaaacctctttcttcggttcagtgcgt
aacccctgggatacccaacgcgtaccgggcggttcgtctggtggttcggccgcggcagtt
gccgcccgtctggctccggcggccaccggcaccgacactggcggctcgatccgccagcca
gccgcgctgtgcaacttgaccggtctgaagccgacttatggcgtggtttcccgctatggg
atgatcgcttttgcctcgtcgcttgatcagggcggtccgatggcggccagcgctgaggat
tgcgccctgctgctcaacacgatggtcggtttcgacgaacgtgattcgacctcgcttgag
cgtccggtcgaagactatgcccgcgatctcgacaagccgcttgatggtttgcgcatcggt
ttgcccaaggaattctttggcgaaggttgtgatgccgaggtgatggccgccgtgcgtgct
gcgattgccgaatacgagaagctcggtgcgacctgcgtcgaaatttctctgcccaattcc
cacttgtcggtgccagcctactatgtgatcgcaccggccgaggccagttccaacctgtcg
cgtttcgacggtgtgcgctatggctatcgtgccccggagtacggcaatctggacgacatg
tacatgaaaacccgagcccagggcttcggtgcagaagtgaagcgccgcatcctgatcggt
gcctatgtgctgtcgcatggctactacgacgcctattatctgcaggctcagcgcattcgc
cgtctgatcgccaacgatttcgtcgaggctttcaagcattgcgatgtgatcatgagccca
acctcaccttcgaccgccttcaagctcggtgaaaaggctgctgatccagtacagatgtac
ctgtcggacatctatacgattgcggttaatctggctggcctgcccggcatgtcgattccc
tgtggttttgtcggtggtttgccggttggcctgcaactgatcggcaattattttgccgag
aaccgcttgctcaatgtcgctcatcgctatcaacaggcgaccgattggcatcaacgtcgc
ccgggtggcattgaataa

DBGET integrated database retrieval system