KEGG   Dechloromonas aromatica: Daro_0120Help
Entry
Daro_0120         CDS       T00259                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dar  Dechloromonas aromatica
Pathway
dar00970  Aminoacyl-tRNA biosynthesis
dar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Daro_0120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dar03029]
    Daro_0120
Enzymes [BR:dar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Daro_0120
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Daro_0120
Mitochondrial biogenesis [BR:dar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Daro_0120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AAZ44879
UniProt: Q47JV2
LinkDB All DBs
Position
136344..137798
Genome map
AA seq 484 aa AA seqDB search
MTQWEVVIGIETHAQLSTVSKIFSGASTAFGAEPNTQACAVDLALPGVLPVLNKKAVECA
IRFGLAIGAEVAQKSVFARKNYFYPDLPKGYQISQMDLPVVVGGNITLQVGQGDKAYEKI
VRLTRAHLEEDAGKSLHEDFHGKSGIDLNRAGTPLLEIVSEPDMRSSDEAVAYARALHAL
VRWIGICDGNMQEGSFRCDANVSVRPKGQAEFGTRREIKNLNSFRFMKEAIDFEVQWQIN
EIEEGRKIQQATVLFDPDTGETRMMRSKEDAHDYRYFPDPDLLPLMIPAEWIARVQGEMP
ELPVQRRERFAGDLGLSAYDASALTASQEIADYFEAVVAIAGKANAKPCANWVMVDLAAR
LNKDGKDIADSPVSAAQLAGLIQRIADSTISNNIAKKVFEALWNGEGATADEVIDKQGLK
QITDTGAIEALVDEVLAANAANVAEFKAGKEKAFNALVGQVMKAAKGKANPQQVNDLLKQ
KLAG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtgggaagtggtaatcggcatcgagacgcatgcgcagctctcgacggtttcg
aagattttttccggcgcctcgacggcgtttggtgccgaaccgaatacccaggcttgcgcg
gttgatctcgcgctgcccggcgttcttccagtgttgaacaagaaagcagtcgagtgcgcc
atccgctttggcttggcgattggtgccgaggtggcgcagaagtccgtttttgcccgcaaa
aactacttttatccggatctgcccaagggctaccagatcagccagatggacctgccggtg
gtggttggcggcaacatcacgctgcaggtcgggcagggcgacaaggcatacgaaaaaatc
gttcgtctgacccgtgcccatcttgaagaagatgccggcaagtcgctgcatgaagatttt
catggcaagtcgggtatcgacctgaatcgggctggtacgccattgctcgaaatcgtttcc
gaaccggacatgcgttcgtccgacgaagcggtcgcctatgcccgggcattgcatgcgctg
gtccgctggatcggcatctgcgacggaaacatgcaggaaggctccttccgctgtgacgcc
aatgtttcggtgcgcccgaaaggccaggccgaatttggcactcgccgcgagatcaagaat
ctcaactccttccggttcatgaaggaagccatcgatttcgaagtccagtggcaaatcaat
gaaatcgaggaaggccgcaagattcagcaggccacagtgctgttcgacccggataccggc
gagacgcgcatgatgcggagcaaggaagacgcgcacgattaccgctacttcccagacccc
gatctattgccgttgatgattccggccgaatggatcgcccgcgttcaaggtgaaatgcca
gagttgccagtgcagagacgcgagcgttttgccggcgacttgggtctttccgcctacgat
gccagcgcgctgacggcaagtcaggaaattgccgattatttcgaggctgtcgtcgcgatt
gccggcaaggccaatgcgaagccctgtgccaactgggtgatggtcgatctggcggcccgt
ctcaacaaggatggcaaggatattgccgattcgccggtttcagcggctcaactggccggt
ctgatccagcggattgccgatagcaccatttccaacaacatcgccaagaaggttttcgaa
gccttgtggaatggcgaaggggcgacggcagatgaggtcatcgacaagcaaggcttgaag
cagattaccgatactggcgccatcgaagctttggtggacgaagtgctcgctgccaatgct
gccaacgtggctgaattcaaggctggcaaggaaaaggcgttcaatgcgctggttggccaa
gtgatgaaagcagccaagggcaaggccaacccgcagcaggtcaatgacctgctgaagcag
aaactggcgggttaa

DBGET integrated database retrieval system