KEGG   Dechloromonas aromatica: Daro_0209Help
Entry
Daro_0209         CDS       T00259                                 

Definition
(GenBank) Penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
dar  Dechloromonas aromatica
Pathway
dar00550  Peptidoglycan biosynthesis
dar01100  Metabolic pathways
dar01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Daro_0209
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Daro_0209
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dar01003]
    Daro_0209
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dar01011]
    Daro_0209
Enzymes [BR:dar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Daro_0209
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Daro_0209
Glycosyltransferases [BR:dar01003]
 Polysaccharide
  Bacterial polysaccharide
   Daro_0209
Peptidoglycan biosynthesis and degradation proteins [BR:dar01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Daro_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AAZ44968
UniProt: Q47JL3
LinkDB All DBs
Position
complement(224264..226579)
Genome map
AA seq 771 aa AA seqDB search
MPSTHSALRLILYPVIFLLGLLAIGIAIALIVLVLAYPNLPSLEVLTDYRPKIPLRVYTA
DGFLIGEYGEERRAVVAIKDVPPIMKQAILAAEDDRFYQHGGIDYTGILRAAGANLIGGG
KRQGASTITQQVARNFFLTGEKTYTRKLYEALLSFKIESNLTKDQIFELYINQIFLGQRA
YGFAAAAQIYFGKPLKDISIAEAAMLAGLPKAPSAYNPVVNPTRAKQRQQYVLRRMHELG
HISDTQYAAALKEPLIVKRELAGYAVHAEYVAEMARQITAERFPEEVYSRGMKVYTTLIK
AEQEAAYISLRKGVMDYDRRHGYRGAESYLDMKDIKSDQDEAIDEALQDIPDTGDLIPAL
VLSADPKQIKVYRKGGEVVTLTGDAMKFAAKMLDDKAPPNKRLKRSAIVRLQKDDKGNWQ
ISQLPEVESAFVAVDPKDGAIRALVGGFDFNRNKFNHVTQAWRQPGSSFKPFIYSASLEK
GFSPNSVIADEPIVIPASQTGTQAWEPHNYDGKYEGPMKMRTALAKSKNMVSIRILQAIG
TQYAQDYAGRFGFDPAKHPPYLTMALGAGSVTPWQMVTAYSVFANGGFKVSPFVVREIRD
EREQILAHSAEIEAGSDNIRVIDPRNAFMMDTMLRDVAIYGTAAKASAILKRQDLAGKTG
TTNEYVDAWFCGYQMTVAGCAWIGFDQPRKLGDKETGGAAALPIWIGYMARALKDVPMQV
PQAPEGLIAYGEGRDRSYIYAENAAKERTPEEESQDATPLPKPDLSTPPSD
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgccttcaacccactcagcgctgcgtctgatcctttaccctgtcatttttctgctcgga
cttctggccatcggaatagcgatagcattgattgtcctcgttctggcctacccgaacctc
ccctcgcttgaggtgctgaccgactatcgcccaaagatacctttacgcgtgtataccgct
gacggcttcctgattggcgaatacggcgaagagcgtcgcgccgtggttgcgatcaaggac
gttccgccgatcatgaagcaggccattctcgccgctgaagacgatcgcttctatcaacac
ggcggtatcgactacaccgggatactgcgtgcggcgggagccaacctgattggcggcgga
aaacgccaaggcgcatcgactatcactcaacaagttgccaggaacttctttctgaccgga
gagaaaacctacacgcgcaaactttatgaggctcttctctctttcaagatagaaagcaat
ctgacgaaagaccagattttcgagttatacatcaatcagatattcctcggccagcgcgcc
tatggatttgctgcggccgcccagatttatttcggcaagccgctaaaagacatctcgatt
gccgaagccgccatgctggccggcctgccaaaagcaccatcggcctacaacccggtcgtg
aacccgactcgcgccaagcaacgccaacagtacgtactgcgccgtatgcatgaattgggg
catatctcggatacccaatatgccgcagccctgaaggaacctctgatcgtcaagcgcgaa
ctggctggctatgccgttcatgccgagtatgtggccgaaatggcgcgccagatcaccgcc
gaacgctttccggaagaagtttattcacgcggcatgaaggtttatacgacactgatcaag
gccgaacaggaagccgcctatatcagcctgcgcaaaggcgtcatggactatgaccgacgg
catggttatcgaggcgccgaatcctatctggacatgaaggacatcaagtccgatcaggac
gaagctatcgacgaagcccttcaggacattcccgataccggcgatcttattccggctttg
gtcctgtcggcagatccaaaacagatcaaggtctaccgcaagggtggcgaagtggtgacg
ctgaccggtgatgccatgaaatttgcggccaagatgctcgacgacaaggcaccgccaaac
aaacgcctgaagcgcagcgccatcgttcgcctgcagaaggacgacaagggcaactggcag
atcagccaactgccagaggttgaatccgcatttgtcgcggtagacccgaaggacggcgcc
attcgcgccttggttggcggtttcgatttcaatcgcaacaagttcaaccatgtcacgcag
gcctggcggcaaccgggttccagctttaaaccattcatctactccgcatcgctggaaaaa
ggtttcagcccgaacagcgtgatcgccgacgaaccaatcgtcattccggccagccagacc
ggcacccaggcttgggagccgcacaactacgatggcaagtatgaaggcccgatgaagatg
cgtaccgcgctggccaagtccaagaacatggtatcgatccgcattctgcaggctatcggg
acgcaatatgctcaggactacgccgggcgcttcggttttgatcccgccaagcacccgcct
tacctgaccatggccctcggcgccggttcggtcaccccgtggcaaatggttaccgcgtac
tccgtgttcgccaacggtggtttcaaggtcagcccattcgtcgtccgcgaaattcgtgac
gaacgcgagcagatattggcccactctgcggagatcgaagccggcagtgacaatatccgg
gtcatcgacccgcgcaacgccttcatgatggacaccatgttgcgcgacgtcgccatctac
ggcacggcggccaaggcatcggcaatcctgaaacgtcaggatctggccgggaagacgggt
acgacaaacgagtatgtcgacgcctggttctgcggctaccaaatgacggttgccggctgt
gcctggattggcttcgaccaaccgagaaaactgggcgacaaggaaaccggtggcgcggcc
gcactgccgatctggattggctacatggcccgtgccctgaaggatgtaccgatgcaggtg
ccgcaagcaccggaaggcctcatcgcctatggcgaaggtcgtgaccggagctatatctat
gccgagaatgccgccaaggaacgtacgcctgaagaagaaagccaggatgcgacgcctctg
cccaaaccggacctgagtacgccacccagcgactaa

DBGET integrated database retrieval system