KEGG   Dechloromonas aromatica: Daro_0215Help
Entry
Daro_0215         CDS       T00259                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
dar  Dechloromonas aromatica
Pathway
dar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01130  Biosynthesis of antibiotics
dar01230  Biosynthesis of amino acids
Module
dar_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daro_0215
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Daro_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 AAA_22 AAA_16 Ploopntkinase3 TsaE AAA AAA_25 dNK Cytidylate_kin APS_kinase AAA_17 SRP54 AAA_7 ABC_tran AAA_5 AAA_28 Arf
Motif
Other DBs
NCBI-ProteinID: AAZ44974
UniProt: Q47JK7
LinkDB All DBs
Position
231806..232357
Genome map
AA seq 183 aa AA seqDB search
MSTQDSAKITTVEHRRNIYLVGLMGAGKTTVGRQLARRLSRPFFDTDHEIVERTGVPIPT
IFEIEGEEGFRRREAQTIYDLTAENNIVLATGGGVVINPENRRRLHDTGWVVYLNVSPVL
LYERTRHDRNRPLLRVEDPLAKLEELHSIRDPLYREVAHIVVDGSHLVASGIVQYLLREF
NRL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaactcaagactcagctaaaatcacgaccgtggaacatcgtcgaaacatatatctt
gtcggtctgatgggggcaggtaaaactactgtcgggcgccaactggcgaggcgactctcc
cgcccatttttcgataccgatcatgagatcgttgaacgaacgggcgtgccgatcccgaca
attttcgaaattgagggggaagagggattccggcgccgagaagcgcagacgatttatgat
cttacggccgagaataatattgttttggcaactggcggcggcgtggtgatcaaccctgag
aatcgtcggcgattgcacgataccggctgggttgtatatctgaatgtatcgccggtgttg
ttgtatgaacgtacacgccatgatcgaaaccgccctctgcttcgcgtcgaagaccctttg
gcaaagttggaggaacttcattcgatccgggaccctctgtatcgggaggtggctcacatt
gtggttgatggctcccatttggttgcctcgggcatcgttcagtatctgttgagggagttc
aaccgtttatga

DBGET integrated database retrieval system