KEGG   Dechloromonas aromatica: Daro_0438Help
Entry
Daro_0438         CDS       T00259                                 

Definition
(GenBank) Protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dar  Dechloromonas aromatica
Brite
KEGG Orthology (KO) [BR:dar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dar01001]
    Daro_0438
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Daro_0438
Protein kinases [BR:dar01001]
 Serine/threonine kinases: Other
  Bacterial family
   Daro_0438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH PEGA Kdo DUF883 Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-ProteinID: AAZ45195
UniProt: Q47IY6
LinkDB All DBs
Position
480379..481752
Genome map
AA seq 457 aa AA seqDB search
MAIEQLGRFKITGTLGQGAMGTVYRAHDPLIERTVAIKTVACAGLSKDEALAFEQRFYRE
AKSAGRLSHPNIVTIHDVGRNESLAFIAMEYLNGQSLRELLDSGVVLPPERCTEIAADVA
DGLAFAHANGVVHRDIKPANIMVLDNGSVKISDFGVALIPSGSTTVEGTAFGSPKYMSPE
QVTGQKVDGRSDIFSLGAVLYEMLAGRPAFDGEELTAVLYQVLHAAPPLPSSFNPELPRV
FDRLIAKSMAKDPDKRYQNATDLAADLRKCRRMLREARKKAEGDDQVRNKRQGRDASSPA
LVKVNPSPWLTAAALASVVSIVGALFWYYGSKPRFEAAPAVSVAENASSPLVPAPESLAP
KVPGVATEGGSKAAKVKSESAASVPVALADGVVRLAIAPWGEVFVDGKMAGVSPPLTEVR
LSPGKHHVEVRNTNFPPHRQVVEVVADKNIRIKHKFQ
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaacaactggggcgattcaagatcaccggaacgctggggcagggagcgatg
ggaaccgtataccgggctcacgatccactgatcgagcgtaccgttgcgatcaagacagtt
gcctgtgccggtctgtctaaagatgaggcgcttgccttcgagcagcgtttttatcgcgag
gctaaatcggccgggcgcctgagtcacccgaacatcgtgaccattcacgatgtcggacgc
aatgaaagcctggccttcatcgccatggaatacctgaacgggcagagtctgcgcgaactg
ctcgattccggtgtcgtcctgccgcccgagcggtgcactgaaattgccgccgatgtggcc
gatggcctggcctttgcccacgccaatggggttgtccatcgtgatatcaagccggccaat
atcatggtccttgataacggttcggtgaagatttccgatttcggcgtcgccttgattccg
agcggttcgacgaccgtcgaggggaccgcgttcggttcgccgaaatacatgtcgcccgag
caggtgaccggccagaaagtcgatggccgttctgacatcttttcccttggtgccgtgctc
tacgagatgctggctgggcgccctgcctttgacggtgaagaattgacggcggtgctttac
caggtgttgcacgcggcgccgcctttgccgtcgagtttcaatccagaattgccgcgagta
ttcgaccgtctgatcgccaagagcatggcgaaagatccggacaagcgctaccagaacgcg
acggatttggcggcagacctgcgcaaatgccggcgcatgctgcgcgaagccaggaaaaag
gccgagggcgatgaccaagtccgtaacaagcgccaggggcgcgatgcttcgtcacctgct
ttggtcaaggttaatccgtccccgtggctgacggctgcggcactggcctccgtggtttcg
atcgttggcgcgctgttctggtattacggaagcaagccaaggttcgaggcagcgccggcg
gttagcgtcgcggaaaatgcctcgtcgccactggttccagcccctgaaagccttgcgcca
aaagtgcctggggtggctactgaaggaggtagcaaggcggccaaagtaaaatccgagagt
gcggcatcggttcctgtggcgctggccgatggggtggtccgcttggcaattgcgccgtgg
ggcgaagtctttgtcgatggcaaaatggccggcgtgtccccgccgttgactgaagtacgg
ctgtcgccgggcaagcatcatgtcgaggtgcgtaataccaacttcccgccccatcggcag
gtggtcgaagtggttgccgacaagaacatccgcatcaagcacaaattccagtga

DBGET integrated database retrieval system