KEGG   Dechloromonas aromatica: Daro_1235Help
Entry
Daro_1235         CDS       T00259                                 

Definition
(GenBank) ATP dependent DNA ligase, central
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dar  Dechloromonas aromatica
Pathway
dar03030  DNA replication
dar03410  Base excision repair
dar03420  Nucleotide excision repair
dar03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dar00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Daro_1235
   03410 Base excision repair
    Daro_1235
   03420 Nucleotide excision repair
    Daro_1235
   03430 Mismatch repair
    Daro_1235
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dar03032]
    Daro_1235
   03400 DNA repair and recombination proteins [BR:dar03400]
    Daro_1235
Enzymes [BR:dar01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Daro_1235
    6.5.1.6  DNA ligase (ATP or NAD+)
     Daro_1235
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Daro_1235
DNA replication proteins [BR:dar03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Daro_1235
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Daro_1235
DNA repair and recombination proteins [BR:dar03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Daro_1235
   NER (nucleotide excision repair)
    Other NER factors
     Daro_1235
   MMR (mismatch exicision repair)
    Other MMR factors
     Daro_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AAZ45991
UniProt: Q47GP0
LinkDB All DBs
Position
1341669..1342508
Genome map
AA seq 279 aa AA seqDB search
MSRLLGALLFGLALSLPMVSSAVEAPPILLANVYRDQVDVARYLVSEKLDGVRAIWDGQA
LRFRSGRPIHAPDWFIAGLPKQPLDGELWIARGQFERVSGIVRREVPDDAGWREVRYMVF
ELPGAPGPFSERADQIRVLAQRANVPWLRAIGQFSVANRASLKKHLDEVVRGGGEGLMLH
LADAAYETGRSDVLLKLKPWQDAEAVVVAHQPGKGRFAGHLGALKVRTPEGREFLLGSGF
SDLQRQQPPAIGTTVTYRFRDLTNKGMPRFASFLRVRDE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcctgcttggcgcgctactcttcggattggcgctttcgctgccgatggtttca
agcgccgtagaagcgcctcccattctgctggccaatgtctatcgcgatcaggtcgatgtt
gcacgctatctggtcagtgaaaaactcgatggcgtgcgggcgatctgggatggtcaggcg
ctgcgtttccggagtggcaggccaatccatgcccctgattggtttatcgccggcctgccg
aaacagccactggatggcgagttgtggattgcgcgtggccagttcgagcgtgtttcgggc
attgttcggcgcgaggttccggatgatgccgggtggcgcgaagtgcgctacatggttttc
gagttgcctggggcgcccgggccattcagtgagcgtgccgaccagattcgtgtcctggcc
cagagggccaatgtcccttggctgcgcgcaatcgggcaattttcggtggccaaccgggct
agcctgaaaaagcatctcgacgaggttgttcggggcggtggcgagggtctgatgctgcac
ctggccgatgcggcctacgaaacggggcgtagcgatgtgctgctcaagctaaaaccctgg
caggatgccgaagcagtggtcgttgctcatcaaccgggtaaagggaggtttgccggacat
ctcggcgccctgaaggtgcgaacgccggaaggccgagagtttctgctgggcagcggtttc
tccgatctgcagcggcaacagccgccagccatcggcacaacagttacctaccgttttcgc
gatctgaccaacaagggcatgccaagatttgccagttttttgcgggttcgtgatgagtaa

DBGET integrated database retrieval system