KEGG   Dechloromonas aromatica: Daro_3914Help
Entry
Daro_3914         CDS       T00259                                 

Definition
(GenBank) Protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
dar  Dechloromonas aromatica
Brite
KEGG Orthology (KO) [BR:dar00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Daro_3914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AAZ48642
UniProt: Q478T9
LinkDB All DBs
Position
complement(4208297..4209061)
Genome map
AA seq 254 aa AA seqDB search
MNEFVSLLPLAHEPVFLALAMGAVVAAYAVFTLVGFGSALMASAPLALVMPVAKVVPMLA
ILDFGGSSLRGWRARKDVAWKEFRQLFPGMLLGQLLGVLVLSRVPATMMAVVLGLFVVFQ
GIRGFSKKTPAADVGVSPAIAYGVFGGVLGGLFGSGGFVYASYLERRLENRAAFRATQAV
LIALSTGWRIVLCLSVGLLDLKLVVVTLIFAPAMALGVYLGQRIDLRISREQLFLFLNGL
LVASGLSLIARFLA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatttgtttccctgcttcctcttgcccatgagcctgtcttccttgcgctggcg
atgggggcggttgtcgcggcctatgccgtcttcacgctggtcggctttggttctgcgctc
atggccagcgcaccattggcactggtcatgccggttgccaaggtggtgccgatgctggcg
atactggattttggcggctcgtccttgcgcggatggcgggctcgcaaggatgttgcctgg
aaggaattccgccagctttttccggggatgctgctcgggcaactgcttggggtgctggtt
ctctcccgcgtaccggcaacgatgatggcggtcgtgcttggtctattcgtggtgtttcag
gggattcgcggtttcagcaaaaaaactccggccgcggatgtcggtgtttctccggcaatt
gcctatggcgtgtttggcggtgtactggggggattgttcggtagcggcggctttgtctat
gcctcgtatctcgaacggcgactggaaaaccgcgccgcattccgggcgacacaagccgtt
ctgattgccttgtcgactggctggcgtatcgtcctgtgcctttctgtcggcttgctggat
ctcaagctcgtggtggtcacgctgatctttgcgccggcgatggccctcggcgtttatctc
ggccagcgcattgatttgcggattagccgggagcaattgttcctgttcctcaatggcctg
ctggtggcgagcgggttgagcctgattgccaggtttctcgcttga

DBGET integrated database retrieval system