KEGG   Pseudodesulfovibrio aespoeensis: Daes_2124Help
Entry
Daes_2124         CDS       T01382                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00970  Aminoacyl-tRNA biosynthesis
das01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:das00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Daes_2124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:das03029]
    Daes_2124
Enzymes [BR:das01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Daes_2124
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Daes_2124
Mitochondrial biogenesis [BR:das03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Daes_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADU63130
UniProt: E6VS85
LinkDB All DBs
Position
complement(2336374..2337807)
Genome map
AA seq 477 aa AA seqDB search
MPRYETVIGLEVHAHLKTRSKIFCSCSTTFGREPNENVCAVCSGMPGVLPVLNAKVPEFA
AKMGLATGCEVNLTSVFARKNYFYPDLPKGYQISQFELPICERGQVAIEVDGQRKVIGLT
RIHMEEDAGKNIHSAAENASFVDLNRAGVPLIEIVSEPDMRSAEEAVAYLKELRSILLYL
GICDGNMEEGSFRCDANVSIRPAGQETLGTRAELKNLNSFKHVQKAIEYEVARQIDLIED
GEAVVQETRLYNADKGTTHSMRGKEEAHDYRYFPDPDLVPLVLDPAWVEQWRAELPELPA
AKRARFMADYGLADYDADLLTGELAVADYYEAAVRAYSGEARKVANWVVGDLLPSLGETG
IAAGDCRLTPARLAGLLALVDDGTISVKIGKDSFRDLCASGDDPAEYVRDRGLAQVSDTG
ELEAMVDRVIAENPSEAEAYRGGKIKLISFFMGQVMRLSKGQANPGVVTKLLQQKLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccccggtacgaaaccgtcatcggcctggaagtgcacgcccacctcaagacccggtcc
aagatattctgctcctgctccaccacctttggcagggagcccaacgagaacgtctgcgcg
gtctgctccggcatgcccggcgtgttgcccgtgctcaacgccaaggtgccggaattcgcc
gccaagatggggctggccaccggttgcgaggtgaacctcacatccgtgttcgcgcgcaag
aattatttttatcccgacctgcccaaggggtatcagatctcccagttcgagctgcccatc
tgcgagcgcgggcaggtggccatcgaggtggacggccagcgcaaggtcattggcctgacg
cgcatccacatggaggaggacgcgggcaagaacatccactccgccgccgagaacgccagc
ttcgtggacctgaaccgggccggggtgccgctcatcgagatcgtgtccgagccggacatg
cgctctgccgaggaggccgtggcctacctcaaggaactgcgctccatcctgctctacctc
ggcatctgcgacggcaacatggaggagggcagtttccgctgcgacgccaacgtctccatc
cgcccggcgggccaggaaacccttggcacccgtgccgagctgaagaacctcaactccttc
aagcacgtccaaaaagccatcgagtacgaggtggctcgtcagatcgacctgatcgaggac
ggcgaagccgtggtgcaggagacccgtctctacaacgcggacaagggcaccacccactcc
atgcgcggcaaggaggaggcccacgactatcgctatttcccggacccggatctggtgccg
ctcgttctggacccggcctgggtggagcagtggcgcgccgagctgcccgagctgcccgct
gccaagcgggcgcgcttcatggccgactacgggctggccgactacgacgccgacctgctc
accggcgagctggccgtggccgactactacgaggccgcggtcagggcctattccggcgag
gccagaaaggtggccaactgggtggtgggcgacctgctgccctctctgggtgagaccggg
atcgcggcgggcgactgccggctgacgcccgccagactggccggattgctcgcgctggtg
gacgacgggaccatctcggtcaagataggcaaggacagctttcgcgacctgtgcgccagt
ggcgacgacccggcggagtacgtccgggacaggggcttggcccaggtatcggataccggc
gagctggaggccatggtggaccgcgtcatcgccgagaacccgtccgaggccgaggcctac
cggggcggcaagatcaagctcataagcttcttcatgggccaggtcatgcgcctctccaag
gggcaggccaaccccggtgtggtgaccaaactgctccagcagaaactctcgtag

DBGET integrated database retrieval system