KEGG   Desulfobacterium autotrophicum: HRM2_07760Help
Entry
HRM2_07760        CDS       T00861                                 

Gene name
glpA2
Definition
(GenBank) GlpA2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00564  Glycerophospholipid metabolism
dat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dat00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HRM2_07760 (glpA2)
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HRM2_07760 (glpA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 FAD_binding_3 Pyr_redox_2 PALP Thi4 3HCDH_N NAD_binding_8 ThiF Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACN13890
UniProt: C0QJN7
LinkDB All DBs
Position
878297..879901
Genome map
AA seq 534 aa AA seqDB search
MEKTIETQVLVIGGGATGTGIARDLALRGVKLILIEKSDLNAGASGANHGLLHSGARYVY
TDAEAAMECLAEGSLLKQIAPHCIEDTGGLFVAVSGDEEGYIADFPGLCQRSGIPCQSLN
LKEVREMEPCLSPNLIAAFGVPDAAIDPFKLSIENLNDALNRGGQYYDHARLESFIVEHH
RIAGARILNMETRELFVIKADIYVSATGAWADCVAARAGVHIPMVYSKGSLLVTGRRMAT
RAINRLRHPSNGDILMPGGVVSILGTTSVRTASPDNLFPSVEEVDMIIDQGEPMIPALGH
CRFIRAYSGVRPLVSAGGGDDRTVSRGFSLLDHARDGVDNFITITGGKLTTFRLMAERTS
DMVCGKLGISAACQTRDLILPRTAGGGWTEPGVALGQKFFSRTKGDPLLCECEMVPASAI
DSLVSTIRKNWAKPDLLAIALRSRIGKGPCQGAFCSVRVLSHLYNQEEVEGPQGADGLRR
FLNERWKGEHALLWGTVLGQSSLKEMIHCGLFCLELEPPYESGDQTGEPTGGQR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacaatcgaaacccaggtgctggtgatcggaggcggggcaacaggtactggt
attgccagggatcttgcccttcgcggagtcaagcttatcctcattgagaaaagcgattta
aatgccggcgcttccggagcaaatcacgggcttttacattctggcgcaagatatgtctat
accgatgccgaggctgccatggaatgcctggcagaagggtcgcttttaaaacagatagcc
ccccattgtattgaagataccggtggactttttgtggcggtatccggggatgaggagggg
tatatcgctgattttcccggcctgtgccagcgttcgggtatcccttgccagtccctgaat
ctaaaagaggtcagggagatggaaccctgtttgtcccctaatttgatcgccgcctttggg
gtgcccgatgcggctattgacccctttaaactttccattgaaaacctcaatgatgcgttg
aaccggggcgggcaatattatgaccatgcccggctggaatcatttatcgttgaacaccat
cgtatcgcgggtgcccgaattttgaacatggaaacccgggaattgtttgtcatcaaggcc
gatatctatgtgagtgccacaggtgcctgggctgattgtgtggctgcccgggccggggtt
catatccccatggtctattccaagggcagtttgctggtcacgggcaggcgaatggcaacc
cgggccattaatcgtctaagacatcccagcaacggcgatatcctcatgcccggcggtgtg
gtttccatccttggcaccacatctgtaagaacggcatctccagacaacctttttcccagc
gttgaagaggtggacatgatcatcgaccagggtgaaccgatgataccggccctggggcat
tgcaggtttatcagggcctattccggggtccgccccctggtcagtgcaggtgggggggat
gaccggaccgtgtccagggggttttcccttctggatcatgccagggacggggtggataat
tttattaccattaccgggggaaaactgaccaccttccggttgatggcggaaagaacctca
gacatggtctgtggcaaacttggcatttctgctgcttgtcaaacccgggatttgatcctt
cccagaactgcaggagggggatggaccgagccaggggttgccctgggccagaagtttttc
tcccggaccaagggagaccctttgttgtgcgaatgtgaaatggtaccggccagcgccatt
gactcccttgtttccaccattcggaaaaactgggcaaagccagaccttttggccattgcc
ctgagaagtcgtattggtaaaggtccctgccagggcgctttctgcagtgtccgggtgctg
tcccatctgtacaaccaggaagaggtggaagggccccagggggccgacgggctccggcgt
ttcttaaatgaacggtggaagggggaacatgccctgttgtggggaaccgtccttggccag
tcttccctgaaggagatgatccattgcggtctgttctgtcttgaacttgaacccccatat
gagtcaggggatcaaaccggagagccaacaggagggcaaagatga

DBGET integrated database retrieval system