KEGG   Desulfobacterium autotrophicum: HRM2_14220Help
Entry
HRM2_14220        CDS       T00861                                 

Definition
(GenBank) zinc-containing dehydrogenase family protein
Organism
dat  Desulfobacterium autotrophicum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ACN14531
UniProt: C0Q9G7
LinkDB All DBs
Position
complement(1623022..1624056)
Genome map
AA seq 344 aa AA seqDB search
MKALKLTGSRHLELVEIQAPEPDGRNVIIRVSACGICGSDLHYWHTGLGMGGVHDLIMGH
EFAGIVTDPGNRDDLVKGDRVTALPLDPCGGCTACQAGHVNICSKALKRSIPGNNGPGGF
AEFVKIRPDMVRKLPASINDVQAAMIEPAAVALHCIRTAGIGPGDKVMISGGGPIGLLCA
AWTKISGVSFVALTEINGFRQDFARQTGHVDEVFDPSDPNFAAQTMKTTQGGFDVVIETS
ASDAGINLGLRMLRPKGRLVLAGINAHTQAILTIMAAVREITQTSVMGYLPEEFDTAMDY
IAQKRIKVEKLVTGTTNLASLGSAFEKLASGTSREMKIVYRAET
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttaaaactcacaggctccaggcacctggaactggtggaaatccaagcacct
gagccggatggcagaaacgttatcatacgagtgtccgcctgcggtatctgcgggtcagat
ctgcattactggcataccgggctaggaatgggcggcgtccatgacctgatcatgggccac
gaatttgccggcattgtcactgaccccgggaaccgggacgacctggtcaaaggagaccgg
gtcacggcattaccattggatccctgcggggggtgcaccgcctgccaggcgggccatgtc
aatatctgctcaaaggcattgaaacgatccattcccggcaacaacggtccaggcgggttt
gctgaatttgtcaaaatccgtccggatatggtaagaaaattgccggccagcatcaacgat
gtccaggccgcaatgattgaaccagcggctgtggcccttcattgcattcgcacggccggc
atcggtcccggggacaaggtcatgatcagcgggggcggccccatcggcctgctgtgcgca
gcctggacaaagatcagcggtgtttcctttgtcgccttgacagaaatcaatgggttccgt
caagacttcgcaaggcagacaggccatgtagacgaggtttttgatccatcagatccgaat
ttcgccgctcaaacaatgaaaacgacccaaggcgggtttgatgtcgtcattgaaacatct
gcttcagatgcaggtatcaatctgggtctgaggatgttaagacccaagggtcgactggtg
cttgccgggattaatgcccatacccaggctatattgacgatcatggcggctgtccgggaa
atcacccagacatctgtaatgggataccttcccgaagaattcgacacggccatggattat
attgcccaaaaaaggatcaaggtggaaaaactggtgaccggcacaacaaatttagccagt
ctgggttctgcctttgaaaaactggcatctggaacgtccagggagatgaagatcgtttac
agggcagagacataa

DBGET integrated database retrieval system