KEGG   Desulfobacterium autotrophicum: HRM2_22630Help
Entry
HRM2_22630        CDS       T00861                                 

Gene name
glpA
Definition
(GenBank) GlpA
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00564  Glycerophospholipid metabolism
dat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HRM2_22630 (glpA)
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HRM2_22630 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_3 HI0933_like FAD_binding_3 NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: ACN15358
UniProt: C0QEL6
LinkDB All DBs
Position
complement(2565314..2566879)
Genome map
AA seq 521 aa AA seqDB search
MKRKKMINVLNDSSRRWDMIIIGGGATGLGSGVDAASRGYSTLVLEQADFAEATSSRSTK
LVHGGVRYLQQGNIALVMEALKERGILLKNAPHLVYNQAFVVPDYRWWERPFYGIGLKLY
DALAGQLGFGPSRILSKIETLERIPTLKTDGLKGGVIYHDGQFDDARLAVTLARTMEDLG
QFPVNHMKVESLIKDNNGFIRGVTARDQITGQTYALKSKVVINATGIFVDSIRRMDDDDS
INMISPSQGIHLILDRSFAPGDSAIMVPHTDDGRVIFIVPWHDRVIVGTTDTPIKEPIME
PVPFPDEITFLLTHAARYLSKIPTKTDVLSVFAGIRPLISGEHAQGNTSFLSRDHHLTIS
PTGLVSIAGGKWTTYRKMAEDTIDNAARLANLMFRPSGTQTLHLHGWTREADIRDHMHVY
GSQADEIKELALALPDLAQPLHKKLPYTGVEVVWAVRHEYALTLADVLSRRTRSLLLDAR
VSMEIAPRVAAIMAEELKKDQSWEDNQVHDYLELAKNYIPS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcaaaaaaatgatcaacgtattaaatgattcatccaggcgatgggatatgatc
atcatcggcggcggagccacagggcttggctcaggggtggatgccgcatcaaggggatac
agtacccttgtccttgaacaggcggactttgcagaggcaacctcaagccggagcaccaag
ctggtccacggtggtgttcgctatctccagcagggaaacattgcccttgtcatggaggcg
ttaaaggaaaggggtattttgctcaaaaatgctccccacctggtgtacaaccaggccttt
gtggttccagactacagatggtgggaacgccccttttatggtattggcctgaaactttac
gatgcgctggcaggccaactgggatttggaccctcccggattttatcaaaaatagagacc
ctggaacggatccccacccttaaaaccgacggtctaaagggtggtgtaatctatcatgac
ggccagtttgacgatgccaggcttgcagtcacccttgcccgaaccatggaggatctgggc
cagttccccgtcaaccacatgaaggtggaatccctgattaaggacaacaatggatttatc
aggggggtcacggcccgggaccagatcacaggacaaacctacgcccttaaatcaaaggtg
gtgatcaatgccacgggcatctttgtggactccatccgcaggatggacgatgacgactcg
atcaacatgatctctcccagccagggaattcaccttatccttgaccgatcctttgcccct
ggggattcggccatcatggtgccccacacggacgacggccgggtaatttttattgtgccc
tggcatgaccgtgtcattgtcggaaccaccgacacccccatcaaggaaccgatcatggaa
ccggttccctttccagatgagatcaccttccttttgacccatgcggcacgttatctttcc
aagattcccacgaaaacggatgtgttgagtgtgtttgccggaattcgaccgctgatctca
ggggagcatgcccagggaaacacctcttttctgtcaagggaccatcacctgaccatctcc
ccaacgggccttgtgagcattgccggtgggaaatggaccacctaccgaaaaatggccgag
gatacaatagataatgcggcccgccttgcaaacctgatgtttcggccatctggaacccag
acgcttcacctccacggctggacccgggaagctgacatcagggaccacatgcatgtctac
ggcagccaggctgatgagataaaagaacttgccctggcgttgcccgatcttgcccaaccc
ctgcataaaaagctgccctacaccggggttgaggtggtctgggccgttcgccatgaatat
gcattgacccttgcagacgtgctttccagaagaacccgttccctgctccttgatgcccgg
gtcagtatggaaattgcgccccgggtggccgcaatcatggcagaagagttgaaaaaagac
cagtcctgggaagacaaccaagtccatgattacttggagcttgcaaaaaattatattccg
agttag

DBGET integrated database retrieval system