KEGG   Desulfobacterium autotrophicum: HRM2_26100Help
Entry
HRM2_26100        CDS       T00861                                 

Definition
(GenBank) putative serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dat  Desulfobacterium autotrophicum
Brite
KEGG Orthology (KO) [BR:dat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dat01001]
    HRM2_26100
Enzymes [BR:dat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HRM2_26100
Protein kinases [BR:dat01001]
 Serine/threonine kinases: Other
  Bacterial family
   HRM2_26100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr cNMP_binding APH Kdo
Motif
Other DBs
NCBI-ProteinID: ACN15704
UniProt: C0QH55
LinkDB All DBs
Position
complement(2980436..2982199)
Genome map
AA seq 587 aa AA seqDB search
MEKSEEKRRRGRKITIPMGIGIAYLQKDGDTPGCLVGQRNPVHFIDLLNKSDEGICLRIT
HSITLEEAFIMQFYDRNEQKWHLCRCVGKWINQDKADPDFFLMGCAYQRLGDKNIESSGD
TFNENASPIDYEFLKVTRFFKTIDRGGLCPLLNAMTFQRVPAGKKIIKQGEQGDACFIIQ
KGICTVYIERGCEKYQIARIKKGNIVGEMAILTGEVRSASVEAETDMEFWRISRDQFDDI
SGKYPDVRNFLTELVTERFSSRKRTAKREIGKYVITDIIGKGGYAMVYGGLHQDLNMAVA
VKMMNHNMAMNENFLKKFRNEARLIAQFNHRNIVRVYDIEERFRTIFIIMEFLQGMSLYE
ELSDVSKLPYPKIVDYLIQISSGLAYAHERGVVHQDIKPANIFIQHGDQVKILDFGVACP
IATENTDFLGTPYYMSPEQIEMESVDERSDIYSLGLLAYEMVTGQRPYPDDDLVRLEELH
VTEDIPDPRNSDPDIPEELRQFILKACSRDREKRYRNIQEVLAQIQPLKEKYGPGKKDIS
RGKRKMTSLILFSNEADQLALNRLLEEFSLKAQALGITLKAADFSDI
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagtgaagagaagagaagacgggggcgaaaaattactatccccatgggaata
gggatcgcatatttacagaaggatggcgatacccccggttgtttggtaggtcagagaaac
cctgtccactttatcgatctgcttaacaaaagtgatgaagggatctgtttgcgtattaca
cacagtataacccttgaagaagcttttataatgcaattctatgaccgcaatgaacaaaaa
tggcacctatgccggtgtgtaggaaaatggataaatcaggacaaggcagatccggatttt
tttttaatggggtgtgcgtatcaaaggttgggtgataaaaatatcgaaagctcaggggac
accttcaacgagaacgcttcccccatagattacgagtttctcaaagtgacccggtttttt
aagaccattgatcgaggcggattgtgtccgcttcttaatgccatgacgtttcagcgggtc
ccagctggaaagaaaataataaaacagggtgaacagggcgatgcctgttttattatccaa
aagggaatctgtacagtttacattgaacgtggatgtgaaaaatatcagatagcccgcata
aagaaaggaaatatcgtcggagagatggccatccttactggagaagtaagaagtgccagt
gttgaagcggaaacagacatggaattctggcgaatctcccgggatcagttcgacgatata
agtggaaaatatccagatgtaagaaattttttgactgaactggttacggagcgtttcagt
tcaagaaaaagaacggcaaaacgagaaataggcaagtatgtgattacggatattattggg
aaaggggggtatgcaatggtgtatggcggcctgcaccaagatctgaatatggccgtggct
gttaaaatgatgaaccacaatatggccatgaatgaaaattttctaaaaaaatttagaaat
gaagcacggcttattgcacaatttaaccaccggaacatagtcagggtctatgatattgaa
gaacgctttcgaactatttttatcatcatggagtttcttcagggaatgtccctttatgaa
gaattatcagacgtgtcaaaactgccttaccccaaaatagttgattatcttattcaaatc
agttcaggattagcctatgcccatgaaagaggtgtggtgcatcaggatatcaaaccggcc
aacatctttatccaacacggtgatcaggttaaaattctcgattttggcgtggcttgcccc
attgcaacggaaaacactgatttcctggggaccccctattatatgtctccggaacagatc
gagatggaatccgttgatgaacgatccgacatctattcccttggtctattggcctatgaa
atggtcacgggtcaacggccttaccctgacgatgaccttgtcaggctggaagagctgcat
gttacagaggatattcctgatccaaggaattctgaccctgatatcccggaagaattgagg
cagtttatcctcaaggcctgttcccgggacagggaaaaaagataccggaacatccaagaa
gtcctggcgcagattcagccgttaaaggagaagtacggccctggcaaaaaagacatttcc
aggggaaaaagaaaaatgacatctcttattcttttttctaatgaagcggatcagctggcg
ttgaatcggttgctggaggagttcagcttaaaagcccaggcacttggcatcaccctgaaa
gccgcggatttttcggatatctga

DBGET integrated database retrieval system