KEGG   Desulfobacterium autotrophicum: HRM2_47640Help
Entry
HRM2_47640        CDS       T00861                                 

Gene name
pdhC
Definition
(GenBank) PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00010  Glycolysis / Gluconeogenesis
dat00020  Citrate cycle (TCA cycle)
dat00620  Pyruvate metabolism
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01130  Biosynthesis of antibiotics
dat01200  Carbon metabolism
Module
dat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HRM2_47640 (pdhC)
   00020 Citrate cycle (TCA cycle)
    HRM2_47640 (pdhC)
   00620 Pyruvate metabolism
    HRM2_47640 (pdhC)
Enzymes [BR:dat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HRM2_47640 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ACN17813
UniProt: C0QHF4
LinkDB All DBs
Position
complement(5372076..5373509)
Genome map
AA seq 477 aa AA seqDB search
MGQRARNFVHFIKFVVLTRRQGGDSVATEILMPKWGLTMKEGKVSKWIKNEGEAVTKGEP
LLEVETSKITNNVESPDDGILFQIVVKAGETVPVQTVLAVLAKEGETPDRREAVVRGGDD
QPSGDAENTVRDGKKEGKAEFVPATPVARRLAREWGIDLARVPGSGPGNRVTESDVRDFK
EKGGDTLPGKTVNAADSALAAAKKAGIDITLVTGSGPDGRITKADVLRAVSPAVQTKTTT
ASSPGPLVAGTIIPLEGMRRIIGDNMMASLQNAAQLSVFVEFDATRMVSFRDKVRKKYES
QSLPRISFNDIIAMVVCRALAKHPLMNSRLTDQGIELCKGVNLGIAVALDNGLVVPNIKS
ADTLGLVEMAMKIRELAQKAKENKLTMDEIQGGTFTISNVSMLGVDGFTPILNPPETGIL
GVGRAKDKPAVHQGKIAVRTLMTLSLTFDHRVVDGVPAMQFLRTLADYLEDPVMMMV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaagagcaagaaatttcgttcactttataaaatttgtggtccttactcgcaga
cagggaggagatagcgtggctactgaaattttgatgcccaaatggggattgaccatgaag
gaaggcaaggtgtccaaatggatcaaaaacgaaggcgaagcagtcacaaaaggcgaaccg
ctgttggaggttgagacgagtaaaatcaccaacaatgtggagtcacccgatgacggaata
ctcttccagattgttgtcaaggccggtgaaaccgttccggttcagacggtactggctgtt
ctggcaaaagagggtgagacgcccgatcgaagagaggccgtggtcaggggcggggacgat
caaccttcgggtgatgcagaaaatactgtcagggatgggaaaaaagagggtaaggctgaa
tttgtaccggccaccccggttgcccggcgactggccagggaatgggggattgatcttgcc
agggtaccaggcagcggacccggcaacagggtgacagagagtgatgttcgcgattttaag
gaaaaagggggcgatacccttcccgggaaaacggtcaatgctgcagatagcgcccttgca
gctgccaaaaaggccggcattgatatcacactcgtcaccggaagcgggcctgacgggcgt
atcaccaaggccgatgtcctgcgagccgtcagcccggcagtccagacaaagaccaccaca
gcctcttcccctgggccgttggttgcaggcaccatcatccccctggaggggatgcggcgg
attattggtgacaatatgatggccagccttcaaaacgcagcccagttatcggtgtttgtg
gagtttgacgccacccggatggtatcgtttcgggacaaggtaaggaaaaaatatgaatct
caatccctgccaaggatttcgtttaacgatattatcgccatggtggtttgtcgggcactg
gcaaagcatccgctgatgaacagcagactcaccgatcaggggattgagctttgcaaaggc
gttaatctgggaatcgccgtggcccttgacaatggtcttgtggtgccgaacatcaagtct
gccgacacccttggtcttgtggaaatggccatgaaaattcgcgaacttgctcaaaaggca
aaggaaaacaagctgaccatggacgaaatccagggcggcacctttaccatcagtaatgtc
agtatgcttggggtggacgggttcacccccatattgaacccgccggaaaccgggattctg
ggggttggccgggcaaaggataagccggcagtccaccagggaaagatagcagtgcgtacc
ttgatgaccctgagcctcacctttgatcaccgggtggttgatggggttccggccatgcaa
tttttaaggaccttggccgattacctggaagatccggtcatgatgatggtgtag

DBGET integrated database retrieval system