KEGG   Desulfobacterium autotrophicum: HRM2_47760Help
Entry
HRM2_47760        CDS       T00861                                 

Gene name
carB2
Definition
(GenBank) CarB2
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00240  Pyrimidine metabolism
dat00250  Alanine, aspartate and glutamate metabolism
dat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    HRM2_47760 (carB2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HRM2_47760 (carB2)
Enzymes [BR:dat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     HRM2_47760 (carB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS ATP-grasp ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 RimK ATP-grasp_2 Epimerase ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACN17825
UniProt: C0QHG6
LinkDB All DBs
Position
complement(5385912..5389136)
Genome map
AA seq 1074 aa AA seqDB search
MPKRTDIHKILIIGAGPIIISQGCEFDYSGTQACKALKEEGYEVILVNSNPATIMTDPET
ADRTYIEPVTPETLAKIIEKERPDALLPTLGGQTGLNTAVEAANMGVLERYNVEMIGASL
EAINKAEDRELFRDAMNKIGLRIPESGFAHNMAEVETISARIGFPIIVRPSFTLGGTGGG
VAYNPEELADLAKSGLDASMITQVMLEESVLGWKEYELEVMRDHAGNVVIVCSIENIDAM
GVHTGDSLTVAPAQTLSDKEYQVLRDASIAIMQEIGVDTGGSNVQFAINPENGEMIIVEM
NPRVSRSSALASKATGFPIAKIAAKLAVGYTLDEITNDITGETLACFEPSIDYCVVKIPR
WTFEKFPETEDILSTAMKSVGETMSIGRTFKEAFQKGLRSLEIGRFGFGADGKDPAPGSI
SRTELEYKLATPNSQRIFFIRHALENGMDIETINALTSIDPWFLFQMKQLVEFDKTITLA
GRELPKEMLKKAKRWGYSDRQLAHLTGNSEEKIERQRKRLGIVPVYKLVDTCAAEFRAAT
PYYYSTYEEECEARVSDRKKVIILGGGPNRIGQGIEFDYCCVHASFALREEGVESIMVNS
NPETVSTDYDTSDKLYFEPLTREDVLHIVEKEKPFGVIVQFGGQTPLNLAMDLERAGVPI
IGTSPDSIDRAEDRDRFQEMLDKLGIAQPANGIAVNIEEAYAVAEKIGYPVMVRPSFVLG
GRAMKIVYDRSALEEYFNLAVLASPDHPVLIDQFLEDAFELDVDAISDGENTVIGGMMEH
IEEAGIHSGDSACVLPPYSISKVHIDEMTEAAKALAKELKVKGLMNIQFGIMDDKVYVIE
VNPRASRTIPFVSKATGVPLAKLATKVMLGKTLAELGLTEQKIPAHFSVKEAVMPFDRFS
KVDPVLGPEMKSTGEVMGIDMDLGAAVAKAQLGAGQNLPTQGTVFISVQDSDKNAALSVA
KDFYDMGFTLIATRGTAMFLGENSIPAKVIEKVSTGRPNVVDAIKNKEIQLILNTGASSQ
TKADGYAIRRSAIRYKVPYATTTDGTRAICKAIQALKRESLTVKAIQEYHKKVN
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacgaaccgacatacacaagattttgattatcggagccggccccatcatcatc
agccaggggtgcgagtttgactattcaggcacccaggcgtgcaaggccctcaaggaagaa
ggatatgaggtgatcctggtcaactccaatcccgccaccattatgaccgatcctgaaaca
gccgatcggacctatattgagccggtcaccccggaaacccttgccaagatcattgaaaaa
gagcggcccgacgccctgctgcccaccctgggcggtcagaccgggcttaacacggctgtg
gaagccgccaacatgggggtgcttgagcgttacaatgtagagatgatcggagcttccctt
gaggccatcaataaggctgaggatcgggagctgttccgggatgccatgaacaaaatcggg
ctgcggattccagaaagcgggtttgcccacaatatggccgaggtcgagaccatttctgcg
aggataggctttcccatcattgtccgacccagtttcaccctgggcggcaccgggggtggt
gtggcctacaaccctgaggaacttgcagaccttgccaagagcggccttgacgcaagcatg
atcacccaggtgatgcttgaggagtcggttctcggctggaaagagtacgagcttgaggtg
atgcgggaccatgccggtaacgtggtgatcgtctgttccatcgagaacattgacgccatg
ggggttcacacgggcgacagcctgaccgtagcccctgcccagaccctgtcggacaaggag
taccaggtcttgagggacgcctccatcgccatcatgcaggagatcggcgttgacacgggt
ggctccaatgtccagtttgccatcaaccctgaaaacggggagatgatcatcgtggagatg
aatcccagggtatcgagaagttctgccctggcctccaaggccacagggtttcccattgct
aaaattgcggcaaagcttgccgtgggatacaccctggatgagatcaccaacgacatcacc
ggcgaaaccctggcctgttttgaaccctccattgattactgcgtggtgaaaattccccgc
tggacctttgagaagtttcccgagaccgaagatatcctttccacggccatgaagagcgtg
ggcgagaccatgagcatcggccggacctttaaggaggcctttcaaaaggggcttcgatcc
cttgagatcggccggttcggattcggggcagacggcaaggatccggcccccggatcgatt
tcccgcaccgagcttgagtacaagcttgctacccctaactcccagcggattttctttatc
aggcacgcccttgaaaacggcatggacattgagaccatcaacgcactcacctccattgat
ccctggttcctctttcagatgaagcagctggtggagtttgacaagacaatcacccttgcc
ggtcgtgaacttcccaaagagatgctgaaaaaggccaaacggtggggctattccgatcgc
cagcttgcccatctcacaggaaacagcgaagaaaagattgaacgacagcgcaaacgcctt
ggcatcgtgcccgtttataagcttgtggacacctgtgccgccgagttcagggctgccacc
ccctactactactccacctacgaggaggagtgtgaagcaagggtttcggatcgaaaaaag
gtgatcatccttggcggtggacccaaccgcatcggccagggcatcgagtttgactattgc
tgcgtccatgcatcgtttgccctcagggaagagggggttgaaagcatcatggtcaactcc
aaccccgaaaccgtgagtacggactacgacacctcggacaagctctattttgagccgttg
acacgggaagatgtgctccacatcgtggaaaaggaaaaaccctttggtgtcattgtccag
ttcggcggccagaccccgctgaaccttgccatggaccttgaacgggcaggggttcccatc
atcggcaccagcccggacagcattgaccgggcagaggacagggaccggttccaggagatg
cttgataagctcggcattgcccagccggccaatggcattgccgtgaacattgaggaggcc
tatgccgttgctgaaaagatcggctatcccgtgatggtccggccgtcgtttgttctcggg
ggcagggccatgaagatcgtgtatgaccgttcagcccttgaggagtatttcaaccttgcc
gtgctcgcctccccggatcatccggtgctcattgatcagttcctcgaggatgcgtttgag
cttgacgtggacgccatctccgacggtgagaacacggtgatcggtggcatgatggagcac
attgaagaggctggtatccactcgggtgattccgcctgtgtgcttcctccctactccata
tcaaaggtccacatcgacgagatgaccgaggcggcaaaggccctggcaaaggagctcaag
gtcaaagggctgatgaacattcagtttggcatcatggatgacaaggtttacgtgattgag
gtcaatcccagggcgtcccggaccattccctttgtgagcaaggccacgggcgttcccctg
gcaaagcttgccaccaaggtgatgctgggaaaaaccctggccgaacttggactgaccgag
cagaagattccggcccatttttcggtaaaagaggctgtcatgccctttgaccggttttcc
aaagtggacccggtgctcggccctgagatgaagtccacgggtgaggtcatgggcattgac
atggaccttggggccgccgttgcaaaggcccagctgggggcgggtcagaacctgcccacc
cagggtacggtgttcatcagcgtccaggacagcgataagaatgcggccctgtccgttgca
aaggatttttacgacatgggttttacccttattgccacaaggggtacggccatgtttctc
ggtgaaaattccatcccggctaaggttattgaaaaggtttccacgggtcggccgaatgtg
gtggatgccatcaagaacaaggagattcagcttattctcaacaccggggccagcagtcag
accaaggccgacggctatgccatccgcaggtcggccattcggtacaaggttccctatgca
accacaactgacggcacacgtgccatctgtaaggccatccaggcccttaaaagagagagc
cttacggttaaggcgatccaggaatatcacaaaaaggtgaattaa

DBGET integrated database retrieval system