KEGG   Desulfobacterium autotrophicum: HRM2_47830Help
Entry
HRM2_47830        CDS       T00861                                 

Gene name
fadD8
Definition
(GenBank) FadD8
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00061  Fatty acid biosynthesis
dat00071  Fatty acid degradation
dat01100  Metabolic pathways
dat01212  Fatty acid metabolism
dat02024  Quorum sensing
Module
dat_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HRM2_47830 (fadD8)
   00071 Fatty acid degradation
    HRM2_47830 (fadD8)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HRM2_47830 (fadD8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dat01004]
    HRM2_47830 (fadD8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dat04147]
    HRM2_47830 (fadD8)
Enzymes [BR:dat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     HRM2_47830 (fadD8)
Lipid biosynthesis proteins [BR:dat01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   HRM2_47830 (fadD8)
Exosome [BR:dat04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   HRM2_47830 (fadD8)
  Exosomal proteins of breast cancer cells
   HRM2_47830 (fadD8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACN17832
UniProt: C0QHH3
LinkDB All DBs
Position
5400378..5402111
Genome map
AA seq 577 aa AA seqDB search
MNVSKWETPFWPEGVAHNISNFHYPLSQVLDNAARRYPENVFTIFNGATKTYAQVKDTAD
RVANFLVEKGIKKGDKVALFLPNIPQFPEIFFGILKAGAVCVNCNPVYTPTELNHQLCDS
EAKMVFCMDHPEFYKNTVKAIVDSDVETVVICNIKSYLPKSKAFIGSLLGKIPKADRHEP
GHLMFDDIVKAARPTPPAVEIDPEKDTAVMLYTGGTTGVPKGAELTHANFTYNIQACEEY
FRFVHKKNEKPDKIRHGGYHTFLGILPWYHSFGITSALLFSVLSASRLVCIPDPRSGKPP
FTDVLKAVEKYRPTFMTAVPTIFVAFTNHPLLKKYDISSLMGCLSGGAPLPPEVCRQFEE
ATGAIIFEAYGLTETAPAVCINPSFKETRKIGSIGFPLPGTDVKILDIETGEHELARGED
GELAVCGPQVMKGYWKRPDANDEVFKTINGQRYFRTGDIAHIDEDGYVVITDRKKDMIIV
GGFNVYPRDVEDIIYTHPKVELVAVVGIPDPKSGESVKAFIKLKPGESMTQEEMIQFCKE
NMAPYKKPRKIEFRDDIPVSNVGKVLRRVLRDEEIKN
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatcaaaatgggaaaccccgttctggccggaaggcgtagcacacaacatatca
aacttccactaccccctttcccaggttcttgacaacgctgcccgacgctatcctgagaat
gtcttcaccattttcaacggtgccaccaaaacctatgcccaggtcaaggatacggcggac
agggtggcaaacttcctcgttgaaaagggcattaaaaagggggacaaggttgcccttttt
ctgcccaacatcccccagtttcccgaaatcttctttggcatcctcaaggccggggccgtt
tgcgtcaactgcaacccggtctacacgccaacggaactcaaccaccagctgtgcgactct
gaagcaaagatggtgttctgcatggatcaccctgaattttacaagaacacggtcaaggcc
atagttgacagtgatgtggaaacggttgtgatctgcaacatcaagtcttaccttccaaaa
tcaaaagcatttatcggctcgctgcttggaaagattcccaaggccgaccgtcatgaaccc
ggccacctcatgtttgacgacattgtcaaggccgcacgtcccacccccccggccgttgag
atagatccagaaaaggatacagccgtcatgctctacacggggggcaccacgggagttccc
aagggagccgagctcacccacgccaactttacctacaatatccaggcctgtgaagagtac
ttcaggttcgtgcacaagaaaaatgaaaagcctgacaaaattcgccacggcggctatcac
accttccttggaatccttccctggtaccacagcttcggcatcaccagcgccctgctcttt
agtgtgctttcggcaagcaggctcgtctgcattccagacccgagatctggcaaaccaccg
tttacagacgttcttaaggccgttgaaaaatatcgccccacctttatgacggcggttccg
accatttttgtggcctttaccaaccatcccctgctgaaaaaatatgacatctcgtccctc
atgggatgtctctccggcggagcacctttgccccccgaggtgtgccggcaatttgaagag
gccacaggtgccatcatattcgaggcctatggcctcacggaaacggcccctgccgtatgc
atcaacccctcgttcaaggagacccgcaaaatcggctccatcggttttcccctgcccgga
acagacgtcaagatcctggacattgagacaggagaacacgaacttgccaggggagaggac
ggcgagcttgccgtgtgcggtccccaggtgatgaagggatactggaaacgtccggacgcc
aatgacgaagtgttcaaaaccatcaacggacaacgctactttcgcaccggcgacatcgcc
cacattgatgaggacggatacgtggtcatcacggaccggaaaaaagacatgatcatcgta
ggcggattcaacgtctacccaagggatgtggaggatatcatatatacccatcccaaggtc
gaactggtggccgttgtgggcattcccgacccgaaaagcggcgagagcgtcaaggctttc
atcaagctcaaacccggcgaaagcatgacccaggaggagatgatccagttctgcaaggag
aacatggccccctataagaagcccagaaaaatcgaattcagggacgatatcccggtatcc
aacgtgggcaaggtattgcgccgggtgctcagggatgaagagataaaaaactga

DBGET integrated database retrieval system