KEGG   Desulfobacterium autotrophicum: HRM2_48060Help
Entry
HRM2_48060        CDS       T00861                                 

Definition
(GenBank) hypothetical protein
Organism
dat  Desulfobacterium autotrophicum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACN17855
UniProt: C0QHJ6
LinkDB All DBs
Position
5427431..5427661
Genome map
AA seq 76 aa AA seqDB search
MDKTESTVEIETVVFRHSIDQYFKNSIKALGNPGVDIIKRDILIDNIRGAVEVVRMFNQS
LGRVVGSIEAPEPPLF
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atggataagaccgaaagcacagttgagattgaaacagtcgtattcaggcattcaatagac
caatattttaaaaactccattaaggcccttggcaatcccggcgttgatatcataaagagg
gatattctcattgacaacatccggggagctgtggaggtggtccgcatgttcaatcagagt
ttgggcagggtggtggggagcatcgaagcaccagaaccgccattgttctaa

DBGET integrated database retrieval system