KEGG   Desulfobacterium autotrophicum: HRM2_48140Help
Entry
HRM2_48140        CDS       T00861                                 

Gene name
tkt1
Definition
(GenBank) Tkt1
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00030  Pentose phosphate pathway
dat01100  Metabolic pathways
dat01110  Biosynthesis of secondary metabolites
dat01120  Microbial metabolism in diverse environments
dat01130  Biosynthesis of antibiotics
dat01200  Carbon metabolism
dat01230  Biosynthesis of amino acids
Module
dat_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HRM2_48140 (tkt1)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    HRM2_48140 (tkt1)
Enzymes [BR:dat01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     HRM2_48140 (tkt1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ACN17862
UniProt: C0QIB8
LinkDB All DBs
Position
5435814..5437817
Genome map
AA seq 667 aa AA seqDB search
MACANKDLDQQCITTIRTLAMDAIQKANSGHPGAPMGLAPAAFVLWKDFLKHNPKNPAWI
DRDRFVLSGGHASMLLYSLLYLNGYGTTLDDIKNFRQWGSKTPGHPEYGHTAGVETTTGP
LGQGVANAVGMAMAERHLGARFNQDGKTLIDHHTYVICGDGDLMEGVTQEAASLAGHLVL
GKLICIYDDNSITIEGTTAIAFTEDVKARFESMNWQVIVVDDGNDLEKIRAAIQAGKDET
SRPTMIKLKTHIAYGSPNKQDSSGAHGAPLGVDEIKLVKKFYGVPEDKDFYVPDEVLAEC
RKAIDIGKEKEQAWQEIFDTYRSETPELADNFVDAISGFLTAGWDDEIPVFTPGDKPMAT
RSASGKVLNAIAKNLPSLMGGSADLAPSNNTFLNDMEVFQADTPQGRNIRFGVREHAMTA
IMTGMYLHSGVRPFGGTFLVFADYMRPAIRVASLMGLPMIYVLTHDSVAVGEDGPTHQPV
EHLASLRAIPGLTVIRPADANETAEAWKKALNTHNGPTALILSRQNLPILDAAADGALVF
GAYTLKKTKGEPDLILIATGSEVHICVEAAALLAKENIQARVVSMPSWELFEKAPAYYRE
RILPPGVKKRLAVEAGIPMGWERYVGDAGKVIGINTFGASAPGDRVLAEYGFTAANIVEQ
AKALVNE
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcgccaacaaagaccttgatcagcaatgtatcaccaccatcagaacccttgcc
atggacgccattcaaaaggcaaactccggccatcccggcgcccccatgggacttgcgccc
gcggcctttgtcctttggaaggattttctaaaacacaaccccaaaaatcccgcctggatt
gaccgggacagatttgttctgtccggcggccatgcatccatgctcctgtacagcctgctc
tacctgaacggctacggaaccacccttgacgacatcaagaacttccgccagtggggcagc
aaaacgccgggacatcctgagtacgggcacacggccggggttgaaaccaccacgggtccc
ctgggccagggtgttgcaaatgccgttggtatggccatggccgaacgccatctcggggca
agattcaaccaggatggaaaaaccctcattgatcatcatacctatgtcatctgcggagac
ggcgacctcatggaaggcgtgacccaggaggctgcctcccttgccggccacctggtcctt
ggaaaactcatctgcatctatgacgacaattcaatcaccatcgagggcacgacagccatt
gcctttaccgaggatgtaaaggcaaggtttgaaagtatgaactggcaggtcatcgtggtg
gacgacggcaacgaccttgaaaaaatcagggccgccattcaggcgggaaaagacgaaaca
tcccgccccaccatgatcaagctcaagacccacatcgcctatggcagtccgaacaagcag
gattcatccggagcccatggtgcccccctgggagtggacgagatcaagctggtaaaaaaa
ttctacggcgtgcctgaggacaaggatttttatgtgcccgacgaggtccttgccgagtgc
cggaaagccattgatattggaaaggaaaaggagcaggcatggcaggaaatctttgacacc
tacaggtccgagacgcccgagcttgccgacaactttgtggatgccatttccggattcctg
acagccgggtgggatgatgaaatccctgtttttacacctggagacaaacccatggccacc
cggtctgcctcgggcaaggtgctcaacgccattgcaaagaacctgccctccctcatgggc
ggatcagccgaccttgccccctccaacaacaccttcttgaacgatatggaggtgttccag
gccgacaccccccagggaagaaacatccggttcggggtgcgtgagcatgccatgaccgcc
atcatgacgggcatgtatctccacagcggtgtccgaccctttggcggcaccttcctcgtg
tttgccgattacatgagaccggccatccgggtggcgtccctcatggggcttcccatgatc
tatgtgctgacccatgacagtgttgccgtgggagaagacggccccacccatcagcccgtg
gagcacctggcatcgttgcgggccattcccggccttaccgttatccggccggcggacgcc
aatgaaaccgcagaggcctggaaaaaggccctgaacacccacaacgggcccacggccttg
atcctgagccgccagaaccttcccattcttgacgcagcagccgacggagcactggtcttt
ggggcctacacccttaaaaagaccaagggcgaacccgatctcatcctcattgcaaccggc
tcagaggttcacatctgcgttgaggcggcagcactcctggccaaagaaaatatccaggca
agggtggtgagcatgccctcgtgggaactttttgaaaaagcgcccgcctactaccgggaa
cgaatccttcctcccggagtcaaaaaacgcctggctgtagaggccggtattcccatgggc
tgggaacggtatgtgggggatgcaggcaaggttatcggtataaacacctttggcgcttca
gcacctggagacagggtacttgcagagtatggattcacagcggcaaatattgttgaacag
gcaaaggcccttgtaaacgaataa

DBGET integrated database retrieval system