KEGG   Desulfobacterium autotrophicum: HRM2_48410Help
Entry
HRM2_48410        CDS       T00861                                 

Gene name
fadB
Definition
(GenBank) FadB
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
dat  Desulfobacterium autotrophicum
Pathway
dat00071  Fatty acid degradation
dat00362  Benzoate degradation
dat00650  Butanoate metabolism
dat01100  Metabolic pathways
dat01120  Microbial metabolism in diverse environments
dat01200  Carbon metabolism
dat01212  Fatty acid metabolism
Module
dat_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HRM2_48410 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HRM2_48410 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HRM2_48410 (fadB)
Enzymes [BR:dat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HRM2_48410 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACN17889
UniProt: C0QIE5
LinkDB All DBs
Position
5465352..5467760
Genome map
AA seq 802 aa AA seqDB search
MVRKIRKAAVIGSGIMGGGIAALLAGAGVNVLLLDIVPFDLKDEEKSDPAARNRIVKAGM
DAALASAPSLFMTKKDAALITTGNLEDDFDKLAECDWIVEVVVENLKIKQALFKRLEAIR
KPDAIISSNTSGIPLKDMSAGLSPEFKQHFMGTHFFNPVRYMHLLELIPGAETLPEVLAF
VAKFGEKHLGKGIVWAKDTPNFVGNRIGVQGIGKVMQLMVEDGMTVPEVDAIFGPALGRP
KTAIFKTTDLVGLDTMSHVCQNSYDLCVDDEQRDAFVVPEYVKKMLEKKLLGNKTRAGFY
KTDLTPEWKKIRKVINPATLEYEDLVRPSFPCLDAAKKKATLAEKIVCVLTGDDKGAKFA
WKMAANSFQYAANRIPEISDTIIEIDNSMKWGYNFEMGPFEVWDTYGVEAAVERMKTENL
EVPANVMAMLAAGNKSFYRLEKGVKEFYDFASASYKAVPVNKTMVSLAAAKGNNKTVFEN
GSASLIDIGDGVFCIEFHTKMNAINGEIVDTIDQSLDHVDANGVGLVIGNEAGGMPGAFS
AGADLAFVSKLCHDKKYAEMDAFLKKAQDGIQRTKYAPFPVVAAPYGMVLGGGCETCLGA
DRIVAHAELFMGLVEIGVGLLPAGGGCMNIWKKFVSALPAGTAKDMDLAKLFIPAFMNVA
MAKVSMSAAQAKGNGYLGLADRIVFNRDNLIGEAKKEVLKMVDDAYAPPAKQRLLVMGNA
GQGMVNGELFNLLCGKMMSEYDAFLAKRIAYVMSGGDVNKNTMVDEEAILKLEREAFVDF
SKEEKTVARIDHMLKTGKPLRN
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggtaagaaagatcagaaaggctgcagtgatcgggtcaggaataatgggtggcggaatc
gccgccctccttgccggtgctggagttaatgtactgcttttggacattgttccgtttgat
ttaaaggacgaagaaaaaagcgacccagcagcaagaaacagaatcgtaaaggcaggcatg
gacgcagcccttgcctctgcaccatcgctgttcatgaccaaaaaagacgccgcactcatc
accacgggcaaccttgaggacgattttgacaagcttgcagaatgcgactggatcgttgaa
gtggttgtggaaaacctgaagatcaaacaggcgctatttaagaggctcgaagcaatcaga
aagcctgatgccatcatcagttccaacacatccggtattcccctcaaggatatgtcagcc
ggtctctcccctgagttcaaacagcacttcatgggaacccattttttcaaccccgtccgc
tatatgcatctccttgagttgatccctggggctgagacccttcccgaagttctggctttt
gtcgccaagtttggcgaaaaacaccttggcaaaggaattgtctgggccaaggataccccc
aactttgtgggtaacagaatcggtgtacagggtattggcaaggtcatgcagctgatggtt
gaagatggcatgaccgttcccgaagtggatgccatttttggtccggcccttggccgaccc
aagactgccatttttaagacaacagaccttgttggtcttgacaccatgtcccatgtctgc
cagaactcctatgatctctgtgttgatgacgaacagcgagacgcctttgtcgttcctgag
tatgtcaaaaaaatgcttgaaaagaaactcctcggcaacaagacccgggcaggtttttac
aagacagatctgacgcctgagtggaaaaaaatcagaaaggtgatcaaccctgccaccctt
gagtatgaagaccttgtaagaccttcgttcccctgcctggatgcagccaagaaaaaagca
acccttgccgaaaagattgtctgcgttctcacgggcgatgataagggcgccaagtttgcc
tggaaaatggcagccaacagcttccagtacgcagccaaccggattcccgagatttcagac
accatcatcgaaatcgacaactccatgaaatggggatacaactttgagatgggccccttt
gaagtgtgggacacctacggggtggaggccgcagttgagagaatgaagactgagaacctt
gaggttcctgccaatgtgatggccatgcttgccgccggcaacaagagcttttacaggctt
gaaaaaggcgtcaaagagttctacgactttgcctcagcatcctataaggccgttcccgtg
aacaagaccatggtttcccttgccgcggcaaagggcaacaacaagacggtttttgaaaac
ggttcagccagcctcatcgacattggtgacggcgtattctgtatcgagttccacaccaag
atgaacgccattaacggtgaaatcgttgacaccattgaccagtccctggaccatgtggat
gccaatggtgtcggcctggtcatcggcaacgaggcaggcggaatgcccggtgcattttcc
gcgggcgccgatcttgcctttgtgtccaaactctgccacgacaaaaaatacgctgaaatg
gacgccttccttaaaaaggcccaggatggtatccagagaaccaaatatgcccccttcccc
gtggttgccgctccctatggaatggtacttggcggcggatgcgagacttgcctgggtgcc
gacaggattgtggcccatgcggagcttttcatgggacttgtggaaatcggcgttggactg
cttcccgcaggtggcggctgcatgaacatctggaaaaaatttgtcagtgcccttcccgca
ggaacggccaaggacatggatcttgcaaaattgttcatcccagccttcatgaacgttgcc
atggcaaaggtttccatgtcagcggcccaggcaaagggcaacggctacctgggacttgcc
gacagaatcgtattcaaccgtgacaatctcattggcgaagccaagaaagaagtattgaaa
atggttgacgatgcctatgcaccccctgccaaacaacgtctccttgtgatgggaaatgcc
ggccagggcatggtcaacggcgaactattcaacctgctctgcggcaaaatgatgagcgag
tatgatgccttccttgccaaacgtatcgcctatgtcatgagcggcggtgatgtcaacaaa
aacaccatggttgatgaggaagcaatcctcaaacttgaacgtgaggcttttgtggacttt
tcaaaagaggaaaagactgtggcaagaatcgaccacatgctgaaaaccggtaaaccgctc
agaaactaa

DBGET integrated database retrieval system