KEGG   Desulfobacterium autotrophicum: HRM2_48820Help
Entry
HRM2_48820        CDS       T00861                                 

Definition
(GenBank) hypothetical protein
Organism
dat  Desulfobacterium autotrophicum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACN17930
UniProt: C0QII6
LinkDB All DBs
Position
complement(5511080..5511301)
Genome map
AA seq 73 aa AA seqDB search
MGGQGACLFQRKSGIVQVAFKPRLIMELMALFMVQVCVVDFLDRKPISMARSQIHDPANP
GNEKEGDRPRLMA
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
ttggggggacagggagcttgcctttttcaaaggaaatcgggtattgttcaggtggctttt
aaacctcgtctgatcatggagttaatggcccttttcatggtacaggtttgtgtcgtggac
tttctcgaccggaagcctatttcaatggcccggtcccagatccacgacccggcaaatcct
ggtaatgaaaaagaaggcgataggcccaggcttatggcttga

DBGET integrated database retrieval system