KEGG   Candidatus Desulforudis audaxviator: Daud_0598Help
Entry
Daud_0598         CDS       T00655                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dau00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Daud_0598
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dau03400]
    Daud_0598
Enzymes [BR:dau01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Daud_0598
DNA repair and recombination proteins [BR:dau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Daud_0598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACA59132
UniProt: B1I253
LinkDB All DBs
Position
634666..635610
Genome map
AA seq 314 aa AA seqDB search
MRYLVPSFSKGDPLVPTVLIGRQKVDLTNLDKVFWPEGYTKGDLVNYYHRVAPYVLRYLR
DRPIVMSRYPDGINGKHFYQKERPEYTPDWIETVLVAHEGAQRVINYIVCRDEATLVWIA
NQGAIEMHAWLGRAGRLEYPDLAVLDLDPAAGAKWRQVIDVALLARTVLAEFGLAGFPKT
SGATGVHVFIPLEPVHTYRETTRAMEAVARLVTGVCAFATTERVIERRTGKVYIDYLQNT
AGKTMAFPYSVRPLPSAPVSTPVTWEELEDLKAAKGFNIKTVPERLQNLGDPYAGLFNRH
YRLDALLELAPSPA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacctggtcccgtctttctcgaagggggatccgcttgtgccgacggtactcatc
ggccgccagaaagtggacctgaccaatctggacaaggtattctggccggaaggatacacc
aagggcgacctggtgaattactaccaccgggtggcgccgtatgtgctccgctacctcagg
gaccggccgatcgtaatgagccggtatccggacgggatcaacggaaaacacttctaccag
aaggagagaccggaatacacgccggactggattgaaacggtgctggtggcccacgagggc
gcccaacgggtgataaactacatcgtgtgccgggacgaggcgaccctggtctggatcgcc
aaccagggggcgatcgagatgcacgcctggctgggcagggccggccgcctcgagtacccg
gatctggccgtcctcgatctggatccggcggcaggggcgaaatggcgccaggtgatcgac
gtggcgctgctggcccgcaccgtgctggccgaattcggcctggccggtttccccaagacc
tcgggagccaccggagtgcacgttttcattcccctggaaccggtgcacacctaccgggag
acgacacgggcaatggaggcggtggcccgcctggtcaccggcgtttgcgcgttcgccacc
accgaacgggtgattgaacggcggaccggcaaagtgtacatcgactatctgcaaaacacg
gcgggtaaaaccatggctttcccgtacagtgtgcgccccctcccgtcggctcccgtgtcc
acccccgtaacctgggaggaactcgaagatctgaaagcggcgaaaggtttcaacataaag
accgtgccggaacgcctacaaaacctgggtgacccctatgccggacttttcaaccgccac
taccgtctggatgccctgctggaactcgccccgtcccccgcttag

DBGET integrated database retrieval system