KEGG   Candidatus Desulforudis audaxviator: Daud_0773Help
Entry
Daud_0773         CDS       T00655                                 

Definition
(GenBank) protein of unknown function DUF557
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dau  Candidatus Desulforudis audaxviator
Pathway
dau00620  Pyruvate metabolism
dau00680  Methane metabolism
dau00720  Carbon fixation pathways in prokaryotes
dau01100  Metabolic pathways
dau01120  Microbial metabolism in diverse environments
dau01200  Carbon metabolism
Module
dau_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Daud_0773
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Daud_0773
   00680 Methane metabolism
    Daud_0773
Enzymes [BR:dau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Daud_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: ACA59295
UniProt: B1I2W1
LinkDB All DBs
Position
801028..802497
Genome map
AA seq 489 aa AA seqDB search
MKTQRKISRTMSTQHPDNVTVPFFANSQDMSGEDEIQEAYYVISHLQCQEQMWDCEGKEV
DNFVVRKLLTQYEHFFAHNRLGRDVFLTLRVPNPTVEHTEGKVLIETLQSIPRSFDAARL
VYGEEIPPIFEVILPMTTSHKCLNRVYYFYKDFVAGRQTLPFYPGDISIAEWVGDFKPEE
INVIPLFEDRHHMLEAAAILRRYLENKPFTYQRVFLARSDPALNYGMISAVLLNKVALQR
LAALEKETGVEIYPILGVGSAPFRGNLKPHTVERVLAEYPDVQTFTIQSAFKYDYPVTTV
LEGIRKINAASRGQAGEVDAERCIRIIDSVSRAYASKVRVLAPVVNYVASAIPPRRKRKL
HIGLFGYARKTSGVSLPRAIGFCAACYSIGLPPELLGYAGLDKEDARYLQTVYHQLDQDL
EDALPFFNEDVFKLVPELRHLLRTELFPFRADEEHRKITSRIIKAVREDRREGLTHLILE
AGYLRGFLG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgaagacacaacgcaaaatttccagaacaatgagcacgcagcaccccgacaacgtgacg
gtacctttctttgccaacagtcaggacatgtccggtgaggatgaaattcaagaagcgtat
tacgtgatttcccacctgcagtgtcaggagcaaatgtgggactgcgaagggaaagaggta
gataattttgttgtcaggaagctcctgacccagtacgagcatttttttgctcataaccgt
ctggggcgggacgttttcctgaccctccgggttcccaaccccacggtggagcacacggaa
ggcaaggttctaattgaaaccctacagtccattccccgttcgtttgatgcggcgcgattg
gtgtacggagaggaaataccccctatctttgaggtcattttgcccatgaccacctcgcac
aagtgcctgaaccgggtttactacttctacaaggactttgttgccggacgccagaccctg
cccttttaccccggagacatctcaatcgccgagtgggtcggcgattttaagcccgaggag
atcaacgtcattcctctttttgaagaccggcaccacatgctggaagctgctgctatcctg
cggcgatacctggaaaacaagccgtttacctaccagcgcgtttttctcgcccgctccgat
cccgccctgaactacggcatgatcagcgccgtcttgttgaacaaggtggccctgcaacgg
ctggccgctctcgaaaaggaaaccggcgtcgaaatatatcccattctcggcgtaggttcg
gctcctttccggggcaacctaaagccgcacacggtggagagggtgctggccgaatacccg
gacgtgcaaacattcaccatccagtcggcgtttaagtacgactacccggtaaccacggtt
ttggagggtataaggaagattaacgcggcgtcccgcgggcaagccggggaagtcgacgca
gagcggtgcatccgcattatcgatagcgtgtcccgcgcgtatgccagcaaggtacgcgtc
ctggcaccggtggtcaactacgtggcctcagccattccaccgcggcgaaagcgcaaactg
cacatcgggttgttcgggtatgcgcggaaaaccagcggcgtgagcctaccgcgcgctatc
ggcttctgcgccgcctgttactcgatcggtctaccgccggaattgctggggtacgcgggc
ctggacaaggaggatgcccgctacctgcaaaccgtataccaccagttagatcaggacctt
gaagatgctttgcccttctttaatgaggatgttttcaagcttgtgccggaattgaggcat
cttctgcgaacggaactgtttcctttccgggcagatgaagaacaccgcaagattacctcg
cgaatcattaaggccgtgcgggaagatcggcgcgaaggtctgacacaccttatactggaa
gctgggtacctgcgcggtttcctgggttaa

DBGET integrated database retrieval system