KEGG   Desulfurella acetivorans: DESACE_00030Help
Entry
DESACE_00030      CDS       T03007                                 

Definition
(GenBank) DNA gyrase subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
dav  Desulfurella acetivorans
Brite
KEGG Orthology (KO) [BR:dav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dav03032]
    DESACE_00030
   03400 DNA repair and recombination proteins [BR:dav03400]
    DESACE_00030
Enzymes [BR:dav01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     DESACE_00030
DNA replication proteins [BR:dav03032]
 Prokaryotic type
  DNA Topoisomerases
   DESACE_00030
DNA repair and recombination proteins [BR:dav03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      DESACE_00030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: AHF96446
UniProt: W0JGQ7
LinkDB All DBs
Position
4678..7104
Genome map
AA seq 808 aa AA seqDB search
MKDLFERVIKTNIIDTMKKSYIDYSMSVIVGRALPDARDGLKPVHRRILYAASELDLLHN
KPYKKSARVVGDVIGKYHPHGDTSVYDAMVRMSQEFTMRYPLIDGQGNFGSIDGDSPAAM
RYTEVRLSKIAEELLKDLDKDTVDFQPNYDESLKEPTVLPSLIPNLLVNGSSGIAVGMAT
NIAPHNLGEVIDALIYYIDSKRTAQTKELLNFIKGPDFPTGAIVMCDSLEEIYEKGLGKI
KIRSLAKIEKIGNKHAIIIEEIPYQVNKANLVKDIAQLVKDKQIEGISDLRDESNKEGIR
IVIEVKSSEQPEIILNNLYKISNLEVSFSINNLCLVDNVPKVLSLKEYFNVFLDFREQVI
KRRTIYLLNIAKERIHILEGLKIAVQNIDEVISIIKKSQTPQIAKDRLKERFNLSDKQTN
AILEMRLSRLTGLEIEKLEKEYNEILEKIKNYEKILGNYDELVSIVKSELIYIKENYSDR
RRTQIVTKLEEINKEDLVKQEKLLITFSNKGYIKSIPLSFYNVQSRGGKGRIAAVYSEDD
YILDCLVLDSLDVVLMFSNNGRIYSIKAYEIPKSSNYTKGKAIVNLLNLKNNEQIKTINA
YKPGNDYVLITQKGIIKRISSDNFSDIKSNGRTIINLLNDDQLVCVIPNVSEKDEIIICT
SLGQSVRFGIEQVRKMGRNAYGVKGISLADNDYVVSGFKLQNKEEKIVLITQNGIAKVIL
ADSIRKVSRGAKGVKIIKLKGEDRLVDAERLQDNSEILITTKLGKLIRIDSNQFREMSRY
AYGVKAIELESDDSVVKVNVTKDQYCDI
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttattcgaaagagttatcaaaacaaatattatagatacaatgaaaaaatcc
tacattgactactctatgagtgttattgtaggaagagccctaccagatgcaagagatggc
ctaaaaccagtacatagaagaatactatatgctgctagtgaacttgatttgttacacaat
aaaccttacaaaaaaagtgctcgtgtagtaggtgatgttattggtaagtatcatccacat
ggcgatacaagcgtttatgatgcgatggtgaggatgagtcaagaatttacaatgagatac
cctctaatagatggtcagggaaattttggatcaattgacggtgatagccctgcggccatg
agatatactgaagttagattatcaaaaattgctgaagagcttttaaaagaccttgataaa
gatactgtggattttcagcctaactatgatgaaagcttaaaagaaccaacagttttgcca
agtctaataccaaatcttttagtaaatggttcatctggtatagctgttggcatggcaaca
aacatcgcacctcataatttaggtgaagtcatagatgcattaatttattatatagatagt
aaaagaactgcccaaacaaaagaattacttaattttatcaaaggacctgattttccaacc
ggtgccattgtaatgtgcgattctttagaagaaatatatgaaaaaggtctgggaaaaata
aaaatacgctcattagcaaaaattgaaaaaattggcaataagcatgcaattataatagaa
gaaataccatatcaggtaaataaagcaaatcttgtaaaagatatagcgcaacttgtaaaa
gataagcaaattgaaggtataagtgatttaagagatgagtcaaacaaagaaggtataaga
attgtaattgaagttaagtcttcggagcagccagaaatcattttaaacaacctctacaaa
ataagtaacttagaagttagcttcagtataaataatttatgccttgtggataatgtgcca
aaagttttgtctttaaaagaatattttaatgtatttttagattttagagaacaggtaatt
aaaagacgaaccatttacctattaaatattgcaaaagaacgtattcatatactagaaggc
ttaaaaattgctgtgcaaaatattgacgaagtaataagcataataaaaaaatcacaaaca
ccccagattgcaaaagatagactcaaagaacgatttaatctaagtgacaaacaaacaaac
gctattttagagatgaggttatcacgattaacaggtttggaaatagaaaaattagaaaaa
gaatacaatgaaatattagaaaagataaaaaattacgaaaaaattctgggtaattacgat
gagctagtatcaatagtaaaaagcgagcttatatatatcaaagaaaattactctgacaga
agaagaacgcaaattgtaacaaaacttgaagaaataaacaaagaagacctggtaaaacaa
gaaaaacttttaataactttttctaataaaggttatataaaatccatacctttatcattt
tacaatgttcaatcgcgaggtggcaaaggtagaatagcagcagtttattcggaagatgat
tacattttagattgtttggttttagatagtctagatgttgtattaatgttctcaaacaat
ggtagaatttattccataaaagcttacgagataccaaaatcaagtaattatacaaaagga
aaagcaatagtaaatcttctgaatttgaaaaataacgagcaaataaaaacaataaatgca
tataaacctggaaatgattacgtgttaattactcaaaaagggataataaaaagaatatct
tcagataatttttcagacattaaaagtaatggtagaacaattattaatttgttaaacgat
gatcagcttgtttgtgttatcccaaatgtatctgaaaaagacgaaattataatatgtacg
tctttgggtcaatctgtaagatttggtatagaacaagttcgcaagatgggtagaaacgcc
tatggtgtaaaaggcattagtttagcagataatgattatgttgtgtctggattcaagctt
caaaataaagaagaaaaaattgtacttattacacaaaacggtatagcaaaagttattttg
gcagattctataagaaaagtatctcggggcgcaaaaggtgtaaaaattattaaattaaaa
ggtgaagatagacttgttgacgcagaaagactccaggataatagcgagattttaattaca
acaaaactgggtaaattaattagaattgattctaatcaatttagagagatgtcaaggtac
gcttatggtgttaaagctatagaacttgaaagcgatgattctgtggtaaaagtaaatgtt
acaaaagaccaatattgcgatatctaa

DBGET integrated database retrieval system