KEGG   Desulfurella acetivorans: DESACE_00675Help
Entry
DESACE_00675      CDS       T03007                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dav  Desulfurella acetivorans
Pathway
dav00030  Pentose phosphate pathway
dav01100  Metabolic pathways
dav01120  Microbial metabolism in diverse environments
dav01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DESACE_00675
Enzymes [BR:dav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     DESACE_00675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N BBE
Motif
Other DBs
NCBI-ProteinID: AHF96530
UniProt: W0JD26
LinkDB All DBs
Position
136265..138073
Genome map
AA seq 602 aa AA seqDB search
MFGGWIGNVLRINLSKMTYAFEPLNYEWAKLYLGGRGLGSKYFMEEVDPTVDPFSEDNKL
ILAPGPLTGTYGAANGRYMMITKSPLTGTIACSNSGGYFPAELKYAGIDLVIIEGKAAHP
VYVTIYNNQVAIKDASKIWGKTSDEAEDYLHSTFHRDAKIASIGPAGEKQVLFAAIMNDK
HRAAGRSGVGAVMGSKNLKAIAVRGTLGVKVADRVKFREAATDAFRAIKESPVTSAGLPA
YGTAVLVNVINQNGLLPTRNFQADVFEDAEKISGETLASTLLVRNKACMSCMIGCARVTK
LVDPRYKAQTGEGPEYETIFALGSDCGVSDLSAITKANYLCNEYGMDPISAGATVACAME
MFEKGIIPQADIGMPLKFGDADAMVKMIELAGKKEGFGEKLALGSYRLASLYGHPEFSMT
VKKQEFPAYDGRVAQGMALEYATSNRGACHVRGYMISPEIMGVPEKLDPYTTENKAFWTK
TFQDVTAVVDSVGMCLFTTFAININHITNLFTAATGLNYTQNDMMKAGERIYNIERLFNL
KAGIDPSQDTLPKRLLEEPVKEGPAKGMVAKLSELLPEYYKERGWGSDGVPTQEKLKELN
IA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtggatggataggaaatgtcttaaggataaacctctctaaaatgacttatgct
tttgagcctttaaactacgagtgggccaagctgtatttaggcggcaggggtcttggttca
aagtatttcatggaagaagtagacccaacggttgacccattttctgaagataataagctg
atacttgccccaggaccgttgactggtacatacggtgcagcaaatggtcgctatatgatg
attacaaaatctcctctaacaggcacgattgcttgttcaaattctggtggttatttccca
gctgaactaaagtatgcgggtattgaccttgtaataatagaaggcaaagcagctcacccg
gtttatgttacaatctataacaaccaggtagccataaaagatgcttctaaaatatggggc
aaaacctctgatgaagcagaagattatctacattcaactttccatagagatgcaaagatt
gcttctattggtccagcaggtgaaaagcaggtattattcgcagctattatgaatgataag
cacagggcagcaggcagaagcggtgttggtgctgtaatgggctcaaaaaatctaaaagct
atagctgtaaggggcacattgggtgttaaggtagcagatagagtaaaatttagagaagcg
gcaacagatgctttcagggcaataaaagaatcgcctgtaacttcagctgggcttcctgca
tatggcacagctgtgcttgtgaatgttataaaccaaaatggcttgcttccaacaagaaac
ttccaggcagatgtgtttgaagatgcagaaaaaatatctggtgagacacttgctagcacc
ttgcttgttagaaataaagcctgtatgtcctgcatgataggatgtgcaagggttacaaaa
ttagttgaccctaggtacaaggctcaaacaggtgaaggtccagagtacgaaacaatattt
gctttgggctcagattgcggcgtatcagatttaagtgcaattacaaaagcaaattattta
tgtaacgagtatggtatggatccaataagcgcaggcgctactgtagcatgtgctatggag
atgtttgaaaaaggcataattcctcaagccgatataggcatgcctctaaagtttggagat
gctgatgcaatggttaaaatgattgagctagcaggtaaaaaagaaggttttggagaaaag
ttagctcttggctcatacaggctcgctagtttgtatggacacccagagttttccatgaca
gtaaaaaaacaggaatttccagcatacgatggtagagtagctcaaggtatggctttggag
tatgctacatcaaaccgtggcgcatgccatgttagaggctatatgatttcaccagaaatt
atgggtgtaccggaaaaacttgatccttatacaacagaaaataaagctttctggacaaaa
actttccaggatgtgacagcagtggtggactctgtgggtatgtgtttgtttaccacattt
gcaataaacataaaccacataacaaacctatttactgcagctactggcttgaattacacg
caaaacgatatgatgaaagcaggagagcgcatatataatatagagcgcttatttaacctc
aaggctggtattgatccatctcaggacacacttccaaaacgcttgcttgaagagccagta
aaagaaggcccggcaaaaggcatggttgcaaagttatctgagcttttgcctgagtactac
aaagagcgtggttggggatctgacggagtgccaacgcaagaaaagctaaaagagctaaat
attgcataa

DBGET integrated database retrieval system