KEGG   Desulfurella acetivorans: DESACE_02035Help
Entry
DESACE_02035      CDS       T03007                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
dav  Desulfurella acetivorans
Pathway
dav00020  Citrate cycle (TCA cycle)
dav00190  Oxidative phosphorylation
dav00650  Butanoate metabolism
dav01100  Metabolic pathways
dav01110  Biosynthesis of secondary metabolites
dav01120  Microbial metabolism in diverse environments
dav01130  Biosynthesis of antibiotics
dav01200  Carbon metabolism
Module
dav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dav_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DESACE_02035
   00650 Butanoate metabolism
    DESACE_02035
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DESACE_02035
Enzymes [BR:dav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DESACE_02035
    1.3.5.4  fumarate reductase (quinol)
     DESACE_02035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like DAO GIDA Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AHF96726
UniProt: W0JHI2
LinkDB All DBs
Position
378542..380344
Genome map
AA seq 600 aa AA seqDB search
MKVKLEEFDVIIVGAGGAGLAAAVQTGLARLKTAVITEVYPTRSHTVSAQGGIAAALGNM
EEDHWIWHMYDTVKGSDYLGDQDAIEEFIKHAPETIYELEHWGVPFSRNENGTIYQRRFG
GHTRNFGESAVQRACAIADRSGHALLHALFERTLRPDIVQYVSYYTEYYAAELFREKETG
RAIGILAWDMVNGGFTMFFGQAVIFATGGNTRNYRTGTNAHINTGDGWKLCLKAGVPIED
PEFVQFHPTGIYGVGNLITEGVRGEGGYLVNGLGERFMPKYAPKVMDLASRDVVSRAMAT
EVREGRGVGPKKDHILLKLDHLGKDLIMSKLPGIWELAYKFVGVDCTKEPIPVQPTAHYH
MGGIPTNIKGEVVDWDGEKEVRIPGLYAAGECACQSVHGANRLGTNSLLDLVVNGKQAGQ
WAARYVLEEKPEWPTPPLENIADEYGKETIEQVKAYFDGGPGEIKMDDIWERLRDSMQHN
MSVFRIESGLKEELKEIDKYFEEFKKVGMTDKSPYFNTELIELLELESLLYVSKVETEAA
LARQESRGGHFRDDYPERDDVNWLKHTLVKWKDGKVELDYKPVRMKGATAPTFPPKKRVY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
ataaaagttaaacttgaagaatttgatgttattatagttggtgctggtggtgcaggtttg
gctgctgctgtgcaaaccggacttgctagactaaaaactgctgttattacagaagtttat
ccaacaagatctcatactgtatctgctcaaggtggtattgcagctgctcttggtaacatg
gaagaagaccactggatttggcatatgtacgatactgttaaagggtctgactacttaggc
gatcaagatgctatagaagagtttattaaacatgcacctgagacaatatacgagctagaa
cactggggagtgcctttttcaaggaatgaaaatggcacaatttaccaaaggcgatttggc
ggacacacaagaaactttggcgagtcagcagttcagagggcatgtgcaatagcagacaga
tccggccatgcattattgcacgcattatttgaacgcacattaagacctgatattgttcaa
tatgtaagttattatacagagtactatgcagcagaattattcagagaaaaagaaactgga
cgagcaataggaattttggcctgggatatggtaaatggtggatttactatgttttttggc
caagcagtaatttttgcaaccggtggcaatacaagaaactatagaactggtactaacgct
catattaatactggagatgggtggaagctttgcttaaaagctggtgttccaattgaagac
ccagagtttgtccaatttcacccaacaggtatttatggtgtcggcaacctcataacagaa
ggtgttagaggtgaaggtggttatttagttaatggtcttggtgagcgttttatgccaaaa
tacgcacctaaagttatggatcttgcctctcgcgatgttgtttcacgtgctatggcaaca
gaagtaagagaaggtagaggcgtgggtccaaagaaagaccacatactgttaaaattagac
catttgggcaaagatttaattatgtcaaaacttccaggaatatgggaacttgcttataaa
tttgtaggtgtggattgtacaaaagaacctataccagtccaaccaacggctcactaccat
atgggtggtatacctactaatataaaaggtgaagttgtagattgggatggtgaaaaagaa
gttagaattccaggtctttatgcagctggtgagtgtgcttgtcaatctgttcatggagct
aacaggcttggtacaaactcattgctagatcttgttgtgaacggtaaacaggcaggacag
tgggcggcaagatatgttttagaagaaaaaccagaatggccgactccaccgcttgaaaat
atagccgatgagtacggtaaagaaactattgaacaggttaaagcttattttgatggtggt
ccaggcgaaattaaaatggatgatatatgggagagattaagagattctatgcagcacaac
atgtctgtgtttagaattgaaagtggacttaaagaagaattaaaagaaatagataaatat
tttgaagaatttaaaaaagttggcatgacagataaaagcccatatttcaacactgagttg
attgagctactagaacttgaatctctactttatgtttctaaagtggaaacagaagctgca
cttgcaaggcaggaaagccgcggtggtcatttcagggatgattatccagaaagggatgat
gtcaattggcttaaacatacccttgtcaaatggaaagatgggaaagtggaacttgactac
aaacctgttagaatgaaaggtgcaactgcgccaacattcccaccaaagaaaagggtatat
taa

DBGET integrated database retrieval system