KEGG   Desulfurella acetivorans: DESACE_02040Help
Entry
DESACE_02040      CDS       T03007                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
dav  Desulfurella acetivorans
Pathway
dav00020  Citrate cycle (TCA cycle)
dav00190  Oxidative phosphorylation
dav00650  Butanoate metabolism
dav01100  Metabolic pathways
dav01110  Biosynthesis of secondary metabolites
dav01120  Microbial metabolism in diverse environments
dav01130  Biosynthesis of antibiotics
dav01200  Carbon metabolism
Module
dav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dav_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DESACE_02040 (sdhB)
   00650 Butanoate metabolism
    DESACE_02040 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DESACE_02040 (sdhB)
Enzymes [BR:dav01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DESACE_02040 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     DESACE_02040 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AHF96727
UniProt: W0JI70
LinkDB All DBs
Position
380356..381078
Genome map
AA seq 240 aa AA seqDB search
MAFDVGDKVIFKVFRYDPAKDKAPYFKDYEVTIERKGMMVLDGLNQIKWHIDGSLSYRRS
CREGVCGSDGMNINGMNTTSCMAHIEDYNSNVLIIKPLPGFPVIKDLVCDFTDFFNKYYA
VKPYLIEKTPPPGTERLQSVEDRAKIDGLYECILCGCCSSSCPSYWADPDYLGPSALLNA
ARFVMDTRDEGSDERLDAVNNIHGVWRCHTILNCIHACPKELNPTKAIASLQKEILKRKY
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgatgttggagataaagtaatatttaaggtatttaggtacgatcctgcaaaa
gataaagctccttattttaaagattatgaagttactatagaaagaaaaggaatgatggtg
cttgatggtttaaatcaaataaagtggcatatagatggttcacttagttatagaagaagc
tgcagggaaggcgtatgtggttctgatggtatgaatataaacggcatgaatacaacttcc
tgtatggctcatattgaggattacaacagcaatgttttaattattaaacctctaccaggt
tttcctgttattaaagatctggtatgcgattttactgacttttttaataagtattatgca
gtaaagccgtatctaatagaaaaaacaccaccacctggaacagagagattgcagagtgta
gaagacagggcaaaaattgatggtttgtatgagtgcatattgtgtggatgctgttcaagc
tcttgtccttcctattgggctgatccagattatttgggtccaagtgcattacttaatgca
gcacgttttgttatggatacaagagatgaaggcagcgatgagagacttgatgctgtaaat
aatatacacggtgtatggcgatgccatactatattaaactgtatacatgcctgcccaaaa
gaattaaaccccacaaaagctatagcatctctccaaaaagagattttaaaacgcaagtac
tag

DBGET integrated database retrieval system