KEGG   Desulfurella acetivorans: DESACE_08195Help
Entry
DESACE_08195      CDS       T03007                                 

Definition
(GenBank) peptidase S11
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
dav  Desulfurella acetivorans
Pathway
dav00550  Peptidoglycan biosynthesis
dav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dav00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DESACE_08195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dav01002]
    DESACE_08195
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dav01011]
    DESACE_08195
Enzymes [BR:dav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DESACE_08195
Peptidases [BR:dav01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   DESACE_08195
Peptidoglycan biosynthesis and degradation proteins [BR:dav01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DESACE_08195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AHF97463
UniProt: W0JFY9
LinkDB All DBs
Position
1544929..1546122
Genome map
AA seq 397 aa AA seqDB search
MKAEKRKKSKLPVLITILIILALIQILRPIGKPKLKLIMATNQTTSGSLQINWPQNTQCA
LAIQNEGFIDKTPNQSPFPTASVAKIMTAYIILKDHPLQFGQNGEALTITKRDVEEYLKD
KADGQSVVKVEAGEKLNERQMLEALLLPSANNIATLLARWDAGSVENFVLKMNQTAKELG
MTNTHYDDPAGISLKTQSSAYDQVLLAQKAFELHTFRSIVGMAQATLPVCGTVYNVNYVL
GKDGIVGIKTGSMPQIGANFVFAADHFVGYKKATIIGAIFGASRKEPLMTALNGAIKALD
SLKPYLDLKEIVKKNQLIATLVYPNGFKTNLIAKDSLSSIVWPSKNIHLQIVLDKELKLP
ISKGQIVGNLIYSDKKIPLVAQSSINKPTLIQKLTRL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagaaaaaagaaaaaaaagtaaattaccagttttgattacaattttaataatt
ttagcgctgatacaaatactaagacctattggcaaaccaaaattaaagcttatcatggcc
actaaccaaacaactagcggctcactacaaataaactggccgcaaaatactcagtgtgcg
cttgcaatacaaaacgaaggatttattgataaaacaccaaatcaatcaccgtttccaaca
gcaagtgtagcaaaaataatgacagcatacatcattcttaaagatcatccgctccaattt
ggccaaaatggagaagcgttaaccataacaaaacgcgatgttgaagaatacttaaaagat
aaagccgatggtcaatccgtagtaaaagtcgaagctggtgaaaaattaaacgaaagacaa
atgctagaagctttgcttttgccatctgcaaataatattgcaactctgcttgcaaggtgg
gatgcaggcagtgttgaaaattttgtattaaaaatgaatcaaacagcaaaagaacttggc
atgacaaatacgcattatgatgatccagctggtattagcctaaagactcaaagcagtgct
tatgaccaggttttactggcgcaaaaagcatttgaactacacacttttagatcaatcgtt
ggtatggctcaagctactttaccagtttgcggcacagtgtataatgtaaactatgtcctt
ggcaaagacggcatagtgggtataaaaacaggctcaatgccacaaattggagctaatttt
gtgtttgctgcagatcattttgttggctacaaaaaagcaactattattggtgcaatattt
ggtgcaagcagaaaagaacctctaatgacagctttaaatggcgcaataaaagctttagat
agcctaaaaccttaccttgacttaaaagaaattgtaaagaaaaatcagttaattgctaca
ttggtttatccaaacggttttaaaacaaatttaattgcaaaagattctctttcatcaatt
gtctggccttcaaaaaatatacatttacagatagtgttggacaaagaactaaaattgcca
attagcaaaggtcaaatagttggcaatctaatttatagtgacaaaaaaataccacttgtt
gctcaaagcagtataaataaaccaacactaatacagaaactaacaagactataa

DBGET integrated database retrieval system