Desulfoglaeba alkanexedens: FDQ92_12965 Help Entry FDQ92_12965       CDS       T05964                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism dax  Desulfoglaeba alkanexedens Pathway dax00190   Oxidative phosphorylation dax01100   Metabolic pathways Module dax_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:dax00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FDQ92_12965 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:dax00194]     FDQ92_12965 (atpE) Photosynthesis proteins [BR:dax00194]  Photosystem and electron transport system   F-type ATPase [OT]    FDQ92_12965 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Ureide_permease Motif Other DBs NCBI-ProteinID:  QCQ23001 UniProt:  A0A4V1ERV9 LinkDB All DBs Position complement(2865254..2865505) Genome browser AA seq 83 aa AA seqDB search MDFTGADLIRAAALLGAGISMGLGAIGPGVGEGYAAGKACEAIGRKPEEAGLLTRTMLVG QAVSESTGIYSLVVALLLMFVVK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggatttcacgggagccgatctcattcgtgcagcggcgcttctcggtgccggaatctcc atgggcctgggcgccatcggaccgggagtgggtgaaggttacgcggccggcaaagcttgc gaggccatcgggagaaagccggaggaagcgggactgctcacccgcaccatgctggtgggc caggcggtctccgagtccaccggcatctattcgctggtcgtggctcttctcttgatgttc gtggtgaagtga

DBGET integrated database retrieval system