KEGG   Drosophila arizonae: 108610896Help
Entry
108610896         CDS       T05886                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
daz  Drosophila arizonae
Pathway
daz00040  Pentose and glucuronate interconversions
daz00051  Fructose and mannose metabolism
daz01100  Metabolic pathways
Module
daz_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    108610896
   00051 Fructose and mannose metabolism
    108610896
Enzymes [BR:daz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     108610896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NCD3G Phosphonate-bd Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 108610896
NCBI-ProteinID: XP_017858757
LinkDB All DBs
Position
2
AA seq 360 aa AA seqDB search
MAQDNLTAVLHGINDLRLEQRPIPEISDEEVLIAMDSVGICGSDVHYLTKGRIGHFVVTK
PMVIGHESAGVVAKVGSKVKNLAVGDRVAIEPGVPCYKCDHCKQGSYNLCPDMAFCATPP
YDGNLTRYYKHAADFCFKLPDHVTMEEAALLEPLSVGVHACRRAGVGLGSKVLILGAGPI
GLVTLLVAQSLGATEILITDLVQQRLDVAKELGATHTLLLNKEDAAEDIADRVRQLMSAE
PDKAIDCCGAESSTRLAIFATRSGGVVVIVGMGPPEMKLPLFNALAREVDIRGVFRYCND
YAAALALVASGRVNVKRLVTHHFDITETQKAFETARDGLGGAIKVMIHVQARNTNNPVVF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggataatctgactgcagttttgcacggaataaacgatttgcgattggaacaa
cgtccgatcccggaaatatcagatgaggaggtgctaatcgcaatggacagcgttgggatc
tgtggatcagatgttcattatttaactaaaggtcgcatcggccactttgtggtgaccaag
cccatggtaattggccacgaaagcgcaggtgtggttgccaaggtgggcagcaaagttaag
aatctggctgtaggagatcgagttgccattgagccgggagttccttgctacaaatgcgat
cattgcaagcaaggcagctacaatctgtgtcctgacatggcattctgtgccacgcccccg
tatgatggtaacctgacccgatactataagcacgcagcggacttttgctttaaattgcct
gatcatgtcaccatggaggaagctgctctactagaaccgttgtccgtgggagtacatgct
tgccgccgtgctggtgtgggcttaggctccaaggtgcttatccttggtgcaggtcccatc
ggactggttacgttactggtagcacaatctttgggagccacggagattctgattacggat
ttagtgcagcaacgtctggatgttgccaaagagttgggcgccacacatacactgctgtta
aataaagaagatgccgcggaagacatcgctgatcgtgtgcgtcaattgatgagtgctgaa
cccgataaggcaatcgactgctgcggagcagagagcagcacgcgactggcaatctttgct
acacgatctggcggtgttgttgttattgttggcatgggaccgcctgaaatgaagctgccc
ctgttcaatgccttggctcgagaggtagacattcgcggtgtcttccgttactgcaatgac
tatgccgctgctttggcactggtggcctctggaagagtgaatgtaaagcgtcttgtaaca
catcattttgatattacagagactcaaaaagcattcgaaacagctcgggacggcttaggt
ggcgccattaaagttatgatacatgtacaagctagaaatacaaataatccagttgtattt
tag

DBGET integrated database retrieval system