KEGG   Drosophila arizonae: 108612677
Entry
108612677         CDS       T05886                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
daz  Drosophila arizonae
Pathway
daz04214  Apoptosis - fly
daz04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:daz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108612677
   04215 Apoptosis - multiple species
    108612677
SSDB
Motif
Pfam: DUF2722 TFIIA MMU163 MDFI Presenilin Band_3_cyto eIF-3_zeta Hydin_ADK MAM33 Kei1 Spt20 DUF908
Other DBs
NCBI-GeneID: 108612677
NCBI-ProteinID: XP_017861122
LinkDB
Position
4
AA seq 153 aa
MAIAYFIPDQAQLLARSRQQQASAQQAGGGVGSSPTNARQNETRQQQQQSQQQQQQQQRQ
QQQQRSGSSQFRANISVPLGREQGAMSMSEFGCWELLAQIFCYALRLYSYNPAQRRPTVI
QISFEISSSGASEANADGGAADAAGDVTDAKQE
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcaatcgcttactttatacccgatcaggcgcaactgttggccagaagcaggcaacaa
caggcaagtgcgcaacaagcaggaggcggcgtcggctccagtccaacgaatgccaggcaa
aacgagacccgacaacaacagcagcaatcacaacaacaacaacaacaacaacaaaggcaa
caacaacaacaacgcagcggcagctcacagtttcgcgccaacatttcagtgccgctgggc
cgcgaacagggcgccatgtccatgtcggagtttggctgctgggagctgttggcccagatc
ttctgctacgccttgcggctgtacagctacaatccagcacagcgccggccgacagtcata
cagatctcgttcgagattagcagcagcggtgcaagcgaggcgaatgcggatggaggtgca
gccgatgcggccggagatgtgacagatgcgaagcaggagtag

DBGET integrated database retrieval system