KEGG   Drosophila arizonae: 108614432
Entry
108614432         CDS       T05886                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
daz  Drosophila arizonae
Pathway
daz04013  MAPK signaling pathway - fly
daz04214  Apoptosis - fly
daz04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:daz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    108614432
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108614432
   04215 Apoptosis - multiple species
    108614432
SSDB
Other DBs
NCBI-GeneID: 108614432
NCBI-ProteinID: XP_017864042
LinkDB
Position
4
AA seq 408 aa
MAVPFHLPVEERDDIASSSSGTSNSSGASTSSGASSSSGASDGASSIASQSPNTTSSATQ
TPMQSPLPTDQVLIALCEWYQQHQRHYINSANATAPHIFQYPPPPSPSCSMAQSPSYTGG
DIFFAHGVYVPPPPQHHQQHHQQQHQQQQQAPRTPHTNLSFAGGEELSFFRQPYPAPTTP
QPMPQQPQPTPQSAPPVHYSHSYPQVSHMLQHHPAASYGHPLPAGAYYATYTPPPTPNTA
NASTSTGAAGATAVPFSRYGVHGPIMASTPLAPGGPKMRLQRSQSDAARRKRLTSTGEDE
REYQSDHETSWDEFDDRYDNFTAGRERLQEFCGRIPPRKKKTNSSSGNNNANPCSSSSNG
SSSSSNSSANESNYSQQPDKEKEQQSFTWPTVVTVFVLAMGWGLYAAR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggctgtgccctttcatctgccggtggaggagagagatgacattgcctcgagctcgtcg
ggcacctcgaattcgtcgggcgcatcgacatcatcgggcgcctcctcgtcgtcgggcgcc
tcagatggcgccagcagcatcgcctcccagtcacccaacacaaccagctcggccacgcag
acgccgatgcagtcgccgctgcccacggaccaggttctaatcgccctctgcgaatggtat
cagcagcatcagcgacactacatcaacagtgccaatgccacggccccgcacatctttcag
tatccgccgccgccgagcccctcctgctcratggcccagtcgcccagctatacgggcggc
gatatattctttgcccatggcgtatacgtgccaccaccgccacagcaccaccaacagcac
caccaacaacaacaccagcagcagcagcaagcgcctcgcacaccgcacaccaacttgagc
tttgcgggcggggaggagctgagcttcttccggcagccgtatccggcgccgacaacgccg
cagccaatgccacagcaaccgcagccgacgccgcagtcggcgccaccggtgcactacagc
cacagctatccgcaggtctcgcacatgctgcagcaccatccagccgcctcctacggccac
ccgctgccggctggcgcctactacgccacctatacgccgccacccacgccgaacacggcg
aatgcctccacgtcgacgggcgcggctggggcaacggctgtgcccttcagccgctacggc
gtccatggcccaatcatggcatcgacacccctggcgccaggcggacccaagatgcgtctg
cagcgcagccaatcggatgcggccagacgcaaaaggttgacctcaacgggcgaggatgag
cgcgagtatcagagcgatcatgagaccagctgggacgagtttgacgatcgctatgacaat
tttacggccggacgcgagcgtctccaggagttctgtggacgcataccgccacgcaagaag
aagaccaattcgagctcgggcaacaacaatgcgaatccatgcagcagcagcagcaacggc
agcagcagcagcagcaatagcagcgccaatgagagcaactacagccagcagccggacaag
gagaaggaacagcagagcttcacttggccaacagttgtcaccgtctttgtgctcgccatg
ggctggggcttgtatgcagcgcgatga

DBGET integrated database retrieval system