KEGG   Drosophila arizonae: 108614747
Entry
108614747         CDS       T05886                                 

Definition
(RefSeq) cell death protein rpr
  KO
K20014  cell death protein rpr
Organism
daz  Drosophila arizonae
Pathway
daz04214  Apoptosis - fly
daz04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:daz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108614747
   04215 Apoptosis - multiple species
    108614747
SSDB
Motif
Pfam: MtrG DUF3177
Other DBs
NCBI-GeneID: 108614747
NCBI-ProteinID: XP_017864481
LinkDB
Position
4
AA seq 67 aa
MAVAFYIPDQKEMLRKAREQEKQLLRLRQWQMATVVLNTIRQLMDSTASECVQRAGRKCG
KWRKPSQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atggctgtggccttctacataccggatcagaaggaaatgctgcgcaaggcgcgcgaacag
gagaagcagctgttgcgtctacgtcaatggcaaatggcaacagttgtattgaacacgata
cgccagctaatggactccacggccagcgagtgcgtgcagcgagcgggacgtaagtgtggc
aagtggcgcaaaccatcgcagtga

DBGET integrated database retrieval system