KEGG   Drosophila arizonae: 108616144Help
Entry
108616144         CDS       T05886                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
daz  Drosophila arizonae
Pathway
daz00020  Citrate cycle (TCA cycle)
daz00190  Oxidative phosphorylation
daz01100  Metabolic pathways
daz01200  Carbon metabolism
Module
daz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
daz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
daz_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108616144
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108616144
Enzymes [BR:daz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108616144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 108616144
NCBI-ProteinID: XP_017866614
LinkDB All DBs
Position
5
AA seq 666 aa AA seqDB search
MSGIMRAPSILAKTAFASMQRVATVAAAATQQRRSYHVTPGYQKAKSANPDAISKQYPIV
DHEYDAIVVGAGGSGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDD
WKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSL
KFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFENDECRGVLALN
LEDGSLHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTALVARQGLPSEDLEFVQFHPT
GIYGAGCLITEGCRGEGGYLINSKGERFMERYAPVAKDLASRDVVSRSITIEVMEGRGVG
PEKDHVFLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGIPTNYR
GQVLTIDENGKDKIVRGLYAAGEAACSSVHGANRLGANSLLDLVVFGRACAKTIAEENKP
GEKAPELKDNAGEFSVANLDKLRHANGNITTADLRLKMQRCMQNHAAVFRDGPILQKGVS
EMKEIYKQFKDIKVIDKSLVWNSDLIETLELQNLLANAQMTIVGAEARKESRGAHAREDF
KDRIDEYDYSKPLESQQKKPLDQHWRKHTLAWVCSDDGDVELKYRPVIDQTLDNEVETVP
PAIRSY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaattatgcgtgcgccatcgattttggccaaaactgcattcgcctcaatgcaa
cgtgtggcaacagtagctgccgcagcgacgcagcagcgccgcagctaccatgtaaccccc
ggataccagaaggctaaatcagcgaatcccgatgccatctccaagcagtatccgattgta
gatcacgaatacgatgcgattgttgtcggtgccggcggttcgggactccgtgctgccttt
ggcctggtcgctgagggcttccgcacagcggttatcactaaactgtttcccacacgctcg
catacgattgctgcacagggaggcattaatgcggctcttggcaatatggaggaggatgac
tggaagtggcacatgtacgatacggtgaagggcagtgactggctgggcgaccaggatgcc
attcattatatgacacgcgaggcacccaaggctgtcattgagctggagaactacggcatg
cccttctctcgcacccaggatggcaagatctatcagcgtgccttcggtggccagagtctg
aagttcggcaagggcggtcaggcccacagatgttgcgccgttgcggatcgtaccggccac
tcgctgctgcacaccctgtatggtcagtcgttgagctacgattgcaactactttgtggag
tactttgctctggatctgattttcgagaatgacgagtgccgtggcgtgctggcccttaat
ttggaggatggtagtctgcatcgcttccgtgcaaagaatacggtcatcgccacaggtggc
tatggacgcgccttcttctcctgcacctcggcgcatacgtgcactggcgatggcaccgca
ttggtggcccgtcagggtctgccgtcagaggatctggagtttgtgcagttccatccgact
ggaatctatggcgccggctgtcttattactgagggctgccgcggtgagggtggctatttg
atcaattccaagggtgagcgtttcatggagcgctatgcgcctgtcgccaaggatttagct
tctcgcgatgttgtctcccgctccattaccattgaggttatggagggccgcggtgtggga
cccgaaaaagatcacgtattcctgcagctgcatcatttgccgcccaaacagctggctgaa
cgtctgcccggcatttcagagactgctatgattttcgccggcgtcgatgtcacccgcgag
cccattcctgtgctgcccaccgtacactacaacatgggtggcatcccaacgaactatcgt
ggccaggtgctgaccattgacgagaacggcaaggacaagattgtgcgcggtctctatgcg
gccggtgaggcagcctgtagctcggtgcatggcgccaatcgattgggtgcaaactccctg
ctggatttggtggtgtttggccgtgcctgcgctaagaccatagccgaggaaaacaaaccc
ggcgagaaagcacccgagctgaaggataatgctggcgagttctctgtggccaatttggat
aagctgcgtcatgcaaatggcaatataaccaccgcagatctgcgtctcaagatgcagcgc
tgcatgcagaaccatgctgctgtattccgcgatggacccatcttgcagaagggcgttagc
gaaatgaaggagatctacaaacagttcaaggacatcaaagttattgacaagtcgcttgtg
tggaactcggatctaattgagacactggagctgcagaatttgctggctaatgctcagatg
accatcgtcggagctgaggcgcgcaaggaatcacgcggcgcacacgcacgcgaagatttc
aaggatcgcatcgatgaatacgactatagcaagcccttggaatcgcagcagaagaaaccc
ctcgaccagcattggcgtaagcacacgctcgcctgggtgtgtagcgatgatggcgatgtg
gaactcaaatacagaccagttattgaccagactctggacaatgaggtagagacggtgcca
ccagcaattcgctcttactag

DBGET integrated database retrieval system