KEGG   Drosophila arizonae: 108618289Help
Entry
108618289         CDS       T05886                                 

Definition
(RefSeq) actin, indirect flight muscle
  KO
K05692  actin beta/gamma 1
Organism
daz  Drosophila arizonae
Pathway
daz04145  Phagosome
daz04391  Hippo signaling pathway - fly
daz04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:daz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    108618289
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108618289
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    108618289
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:daz03021]
    108618289
   03019 Messenger RNA biogenesis [BR:daz03019]
    108618289
   03036 Chromosome and associated proteins [BR:daz03036]
    108618289
   03029 Mitochondrial biogenesis [BR:daz03029]
    108618289
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:daz04812]
    108618289
   04147 Exosome [BR:daz04147]
    108618289
Transcription machinery [BR:daz03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     108618289
Messenger RNA biogenesis [BR:daz03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     108618289
Chromosome and associated proteins [BR:daz03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     108618289
    NuA4 complex
     108618289
  Chromatin remodeling factors
   BAF complex
    108618289
   PBAF complex
    108618289
   SWR1 complex
    108618289
Mitochondrial biogenesis [BR:daz03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    108618289
Cytoskeleton proteins [BR:daz04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     108618289
Exosome [BR:daz04147]
 Exosomal proteins
  Proteins found in most exosomes
   108618289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin GerD
Motif
Other DBs
NCBI-GeneID: 108618289
NCBI-ProteinID: XP_017869752
LinkDB All DBs
Position
2
AA seq 376 aa AA seqDB search
MCDDDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKS
YELPDGQVITIGNERFRCPEALFQPSFLGMESSGIHETVYNSIMKCDVDIRKDLYANSVL
SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYDESGPGIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgacgatgatgcgggtgcattggttatcgacaacggttcgggcatgtgcaaagcc
ggctttgctggtgatgacgccccccgtgctgtattcccctcgattgtgggtcgtccacgc
caccagggtgtgatggtgggtatgggtcagaaggattcgtacgtgggtgatgaggcgcag
agcaagcgtggtattctcacgctcaaatatcccattgagcatggcatcatcaccaactgg
gatgacatggagaagatctggcatcataccttctacaatgagttgcgcgtggcccccgag
gagcatccagtattattgacagaggccccactgaaccccaaggccaatcgcgagaagatg
actcagattatgttcgagaccttcaattcgccagccatgtacgttgccatccaggccgtg
ctctccctgtacgcttccggccgtaccactggtattgtgttggactccggtgacggtgtc
tcccacactgtgcccatctatgagggcttcgccctgccccatgccatcctgcgtctggac
ttggccggccgcgacttgaccgactatctgatgaagatcctgaccgagcgtggctactcc
ttcaccaccactgccgagcgtgaaattgtgcgcgacatcaaggagaagttgtgctatgtg
gctctggacttcgagcaggaaatggccactgctgccgcctccacctcgctggagaagtcg
tacgagttgcccgatggccaggtcatcaccattggcaacgagcgtttccgttgccccgag
gctctgttccagccctcgttcttgggcatggagtcgtctggtattcatgagactgtctac
aactcgatcatgaagtgcgatgttgatatccgcaaggatctgtatgccaactctgtgctg
tccggcggtactaccatgtatccaggtattgctgatcgtatgcaaaaagagatcaccgct
ctggccccatcgaccatcaagatcaagatcattgcgccacctgagagaaagtactccgtc
tggattggtggctccatcctggcttctctgtccaccttccagcagatgtggatctccaag
caggaatacgatgagtctggtcccggcattgtgcaccgcaagtgcttttaa

DBGET integrated database retrieval system